ELM   Currently 128 Elms in ELM database.

o Summary of features reported by ELM. (Mouseover the matches for details.)

LIG_CtBPTRG_ENDOCYTIC_2LIG_SH3_1LIG_CYCLIN_1MOD_GSK3_1LIG_TRAF6LIG_APCC_Dbox_1MOD_CK1_1LIG_MAPK_1MOD_PLKLIG_14-3-3_3 LIG_SH2_STAT5LIG_SH2_STAT3LIG_SH2_SRCSubmit to SmartSubmit to PfamMOD_ProDKin_1LIG_ULM_U2AF65_1LIG_PP1MOD_PKA_2MOD_CK2_1LIG_SH3_3LIG_SH2_GRB2MOD_PIKK_1Submit to GlobPlotLIG_PDZ_3LIG_WW_4LIG_BRCT_BRCA1_1HelpHelpHelpHelpHelpHelpHelpHelpHelpHelpHelpLIG_CtBP: [7,11] GMSLETRG_ENDOCYTIC_2: [113,116] YPDMTRG_ENDOCYTIC_2: [171,174] YEDVTRG_ENDOCYTIC_2: [297,300] YGGLLIG_SH3_1: [18,24] RPPPPPPLIG_SH3_1: [264,270] YGTPASPLIG_CYCLIN_1: [187,191] KSLAPMOD_GSK3_1: [43,50] LENSASESMOD_GSK3_1: [91,98] RQRTHFTSMOD_GSK3_1: [193,200] PLSTKSFT
[197,204] KSFTFFNS
[203,210] NSMSPLSS
[212,219] SMFSAPSS
[215,222] SAPSSISS
[221,228] SSMTMPSSMOD_GSK3_1: [248,255] LTGSSLNSMOD_GSK3_1: [274,281] YRDTCNSS
[277,284] TCNSSLAS
[286,293] RLKSKQHSLIG_TRAF6: [37,45] ADPREPLENLIG_TRAF6: [168,176] VQPYEDVYALIG_APCC_Dbox_1: [39,44] PREPLEMOD_CK1_1: [48,54] SESSDTE
[50,56] SSDTELPMOD_CK1_1: [195,201] STKSFTFMOD_CK1_1: [206,212] SPLSSQS
[209,215] SSQSMFS
[212,218] SMFSAPS
[215,221] SAPSSIS
[218,224] SSISSMT
[219,225] SISSMTM
[221,227] SSMTMPSMOD_CK1_1: [252,258] SLNSAMS
[255,261] SAMSPGAMOD_CK1_1: [269,275] SPYSVYRMOD_CK1_1: [281,287] SLASLRLLIG_MAPK_1: [145,155] RKRERNQQLDL
[146,155] KRERNQQLDL
[147,155] RERNQQLDLMOD_PLK: [43,49] LENSASEMOD_PLK: [104,110] LEATFQRMOD_PLK: [114,120] PDMSMRELIG_14-3-3_3: [197,202] KSFTFFLIG_SH2_STAT5: [160,163] YVPQLIG_SH2_STAT3: [160,163] YVPQLIG_SH2_SRC: [171,174] YEDVSmart: low_complexity_region: 
[10,24] LERLPEGLRPPPPPPSmart: low_complexity_region: 
[54,68] ELPEKERGGEPKGPE
[69,84] DSGAGGTGCGGADDPASmart: HOX: 
[89,151] QRRQRTHFTSQQLQELEATF
QRNRYPDMSMREEIAVWTNL
TEPRVRVWFKNRRAKWRKRE
RNQSmart: low_complexity_region: 
[204,231] SMSPLSSQSMFSAPSSISSM
TMPSSMGPPfam:OAR: 
[275,295] RDTCNSSLASLRLKSKQHSS
FMOD_ProDKin_1: [203,209] NSMSPLSMOD_ProDKin_1: [255,261] SAMSPGA
[263,269] PYGTPAS
[266,272] TPASPYSLIG_ULM_U2AF65_1: [140,145] RRAKWRLIG_PP1: [132,138] RVRVWFKMOD_PKA_2: [274,280] YRDTCNSMOD_CK2_1: [43,49] LENSASE
[48,54] SESSDTEMOD_CK2_1: [114,120] PDMSMRELIG_SH3_3: [16,22] GLRPPPP
[17,23] LRPPPPP
[18,24] RPPPPPPLIG_SH3_3: [33,39] LARPADP
[36,42] PADPREPLIG_SH3_3: [61,67] GGEPKGPLIG_SH3_3: [232,238] GAVPGMPLIG_SH3_3: [264,270] YGTPASPLIG_SH2_GRB2: [181,184] YNNWMOD_PIKK_1: [95,101] HFTSQQLMOD_PIKK_1: [207,213] PLSSQSMDisOrder: [1,84] MDAFKGGMSLERLPEGLRPP
PPPPHDMGPAFHLARPADPR
EPLENSASESSDTELPEKER
GGEPKGPEDSGAGGTGCGGA
DDPADisOrder: [199,275] FTFFNSMSPLSSQSMFSAPS
SISSMTMPSSMGPGAVPGMP
NSGLNNINNLTGSSLNSAMS
PGACPYGTPASPYSVYRDisOrder: [293,314] SSFGYGGLQGPASGLNACQY
NSGlobDom: [85,198] KKKKQRRQRTHFTSQQLQEL
EATFQRNRYPDMSMREEIAV
WTNLTEPRVRVWFKNRRAKW
RKRERNQQLDLCKGGYVPQF
SGLVQPYEDVYAAGYSYNNW
AAKSLAPAPLSTKSLIG_PDZ_3: [10,13] LERL
[14,17] PEGLLIG_PDZ_3: [40,43] REPLLIG_PDZ_3: [119,122] REEILIG_PDZ_3: [171,174] YEDVLIG_WW_4: [203,208] NSMSPLLIG_WW_4: [255,260] SAMSPGLIG_WW_4: [263,268] PYGTPA
[266,271] TPASPYLIG_BRCT_BRCA1_1: [197,201] KSFTF F9SD_RaOEQd.png

o Filtering summary

User supplied cellular location(s): nucleus, cytosol
User supplied taxon: Homo sapiens

(An ELM is listed as filtered when all its matching instances have been filtered out.)

ElmsInstances
retained2159
Species filtered13
Smart filtered418
Cellular location
filtered
722
all found
(before filtering)
3299
   
Query sequence:
>unknown MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKER
GGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMRE
EIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYS
YNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNS
GLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGL
QGPASGLNACQYNS


o Globular domains/ TM domains and signal peptide detected by the SMART server

Domain Start End
HOX 89 151
Pfam:OAR 275 295


o Results of ELM motif search after globular domain filtering and context filtering.

All matches falling inside SMART/PFAM domains are excluded from this list.

Elm Name Instances
(Matched Sequence)
Positions PHI-Blast Instance Mapping Elm Description Cell Compartment Pattern
LIG_14-3-3_3
KSFTFF
197-202
- Consensus derived from natural interactors which do not exactly match the mode1 and mode2 ligands nucleus,
cytosol,
internal side of plasma membrane
[RHK][STALV].[ST].[PESRDIF]
LIG_APCC_Dbox_1
PREPLE
39-44
- An RXXL motif that binds to the Cdh1 and Cdc20 components of APC/C thereby targeting the protein for destruction in a cell cycle dependent manner nucleus,
cytosol
.R..L.
LIG_BRCT_BRCA1_1
KSFTF
197-201
- Phosphopeptide motif which directly interacts with the BRCT (carboxy-terminal) domain of the Breast Cancer Gene BRCA1 with low affinity nucleus,
BRCA1-BARD1 complex
.S..F
LIG_CtBP
GMSLE
7-11
- PxDLS motif that interacts with the CtBP protein nucleus [PG][LVIPME][DENS]L[VASTRGE]
LIG_CYCLIN_1
KSLAP
187-191
- Substrate recognition site that interacts with cyclin and thereby increases phosphorylation by cyclin/cdk complexes. Predicted protein should have the MOD_CDK site. Also used by cyclin inhibitors. nucleus,
cytosol
[RK].L.{0,1}[FYLIVMP]
LIG_WW_4
NSMSPL
SAMSPG
PYGTPA
TPASPY
203-208
255-260
263-268
266-271
- Class IV WW domains interaction motif; phosphorylation-dependent interaction. nucleus,
cytosol
...[ST]P.
MOD_CK1_1
SESSDTE
SSDTELP
STKSFTF
SPLSSQS
SSQSMFS
SMFSAPS
SAPSSIS
SSISSMT
SISSMTM
SSMTMPS
SLNSAMS
SAMSPGA
48-54
50-56
195-201
206-212
209-215
212-218
215-221
218-224
219-225
221-227
252-258
255-261
- CK1 phosphorylation site nucleus,
cytosol
S..([ST])...
MOD_CK2_1
LENSASE
SESSDTE
43-49
48-54
- CK2 phosphorylation site nucleus,
cytosol,
protein kinase CK2 complex
...([ST])..E
MOD_GSK3_1
LENSASES
PLSTKSFT
KSFTFFNS
NSMSPLSS
SMFSAPSS
SAPSSISS
SSMTMPSS
LTGSSLNS
43-50
193-200
197-204
203-210
212-219
215-222
221-228
248-255
- GSK3 phosphorylation recognition site nucleus,
cytosol
...([ST])...[ST]
MOD_PIKK_1
PLSSQSM
207-213
- (ST)Q motif which is phosphorylated by PIKK family members nucleus ...([ST])Q..
MOD_PLK
LENSASE
43-49
- Site phosphorylated by the Polo-like-kinase nucleus,
cytosol
.[DE].[ST][ILFWMVA]..
MOD_ProDKin_1
NSMSPLS
SAMSPGA
PYGTPAS
TPASPYS
203-209
255-261
263-269
266-272
- Proline-Directed Kinase (e.g. MAPK) phosphorylation site in higher eukaryotes. nucleus,
cytosol
...([ST])P..
LIG_PDZ_3
LERL
PEGL
REPL
YEDV
10-13
14-17
40-43
171-174
- Class III PDZ domains binding motif cytosol,
plasma membrane,
membrane
.[DE].[IVL]
LIG_SH2_GRB2
YNNW
181-184
- GRB2-like Src Homology 2 (SH2) domains binding motif. cytosol Y.N.
LIG_SH2_SRC
YEDV
171-174
- Src-family Src Homology 2 (SH2) domains binding motif. cytosol Y[QDEVAIL][DENPYHI][IPVGAHS]
LIG_SH2_STAT3
YVPQ
160-163
- YXXQ motif found in the cytoplasmic region of cytokine receptors that bind STAT3 SH2 domain. cytosol Y..Q
LIG_SH2_STAT5
YVPQ
160-163
- STAT5 Src Homology 2 (SH2) domain binding motif. cytosol Y[VLTFIC]..
LIG_SH3_1
RPPPPPP
YGTPASP
18-24
264-270
- This is the motif recognized by class I SH3 domains cytosol,
plasma membrane,
focal adhesion
[RKY]..P..P
LIG_SH3_3
GLRPPPP
LRPPPPP
RPPPPPP
LARPADP
PADPREP
GGEPKGP
GAVPGMP
YGTPASP
16-22
17-23
18-24
33-39
36-42
61-67
232-238
264-270
- This is the motif recognized by those SH3 domains with a non-canonical class I recognition specificity cytosol,
plasma membrane,
focal adhesion
...[PV]..P
LIG_TRAF6
ADPREPLEN
VQPYEDVYA
37-45
168-176
- TRAF6 binding site. Members of the tumor necrosis factor receptor (TNFR) superfamily initiate intracellular signaling by recruiting the C-domain of the TNFR-associated factors (TRAFs) through their cytoplasmatic tails. cytosol ..P.E..[FYWHDE].
TRG_ENDOCYTIC_2
YEDV
YGGL
171-174
297-300
- Tyrosine-based sorting signal responsible for the interaction with mu subunit of AP (Adaptor Protein) complex cytosol,
plasma membrane,
clathrin-coated endocytic vesicle
Y..[LMVIF]


o List of excluded ELMs falling inside SMART/PFAM domains.

Matches in this list are only likely to be of interest if they are in surface-exposed loops.
Consult the SMART or PFAM entries for useful links to solved 3D structures.

Elm Name Positions PHI-Blast Instance Mapping Elm Description Cell Compartment Pattern
LIG_MAPK_1
145-155
146-155
147-155
- MAPK interacting molecules (e.g. MAPKKs, substrates, phosphatases) carry docking motif that help to regulate specific interaction in the MAPK cascade. The classic motif approximates (R/K)xxxx#x# where # is a hydrophobic residue. nucleus,
cytosol
[KR]{0,2}[KR].{0,2}[KR].{2,4}[ILVM].[ILVF]
LIG_PP1
132-138
- LIG_PP1 is a conserved PP1c (protein phosphatase 1 catalytic subunit)- binding motif protein phosphatase type 1 complex,
nucleus,
cytosol
..[RK].{0,1}[VI][^P][FW].
LIG_ULM_U2AF65_1
140-145
- Pattern encompassing the ULMs in SF1 and SAP155 which bind to the UHM of U2AF65 nucleus,
spliceosome complex
[kr]{1,4}[kr].[kr]w.
MOD_CK1_1
269-275
281-287
- CK1 phosphorylation site nucleus,
cytosol
S..([ST])...
MOD_CK2_1
114-120
- CK2 phosphorylation site nucleus,
cytosol,
protein kinase CK2 complex
...([ST])..E
MOD_GSK3_1
91-98
274-281
277-284
286-293
- GSK3 phosphorylation recognition site nucleus,
cytosol
...([ST])...[ST]
MOD_PIKK_1
95-101
- (ST)Q motif which is phosphorylated by PIKK family members nucleus ...([ST])Q..
MOD_PLK
104-110
114-120
- Site phosphorylated by the Polo-like-kinase nucleus,
cytosol
.[DE].[ST][ILFWMVA]..
LIG_PDZ_3
119-122
- Class III PDZ domains binding motif cytosol,
plasma membrane,
membrane
.[DE].[IVL]
MOD_PKA_2
274-280
- PKA phosphorylation site cytosol .R.([ST])...
TRG_ENDOCYTIC_2
113-116
- Tyrosine-based sorting signal responsible for the interaction with mu subunit of AP (Adaptor Protein) complex cytosol,
plasma membrane,
clathrin-coated endocytic vesicle
Y..[LMVIF]