USR1:A(size=496) vs USR2:A(size=750)
Structure Alignment
Rmsd = 3.8 Z-Score = 5.6
Sequence identity = 15.5%
Aligned/gap positions = 328/194

Sequence alignment based on structure alignment.
Sequence alignment based on structure alignment. Position numbers according to sequence (starting from 1) and according to PDB are given as SSSS/PPPP, SSSS - sequence, PPPP - PDB.

USR1:A - MOL_ID: 1; MOLECULE: AMYLASE; CHAIN: A; EC: 3.2.1.1; OTHER_DETAILS: HUMAN SALIVARY AMYLASE

USR2:A - MOL_ID: 1; MOLECULE: ISOAMYLASE; CHAIN: A; SYNONYM: GLYCOGEN 6-GLUCANOHYDROLASE; EC: 3.2.1.68




USR1:A 10/11 RTSIVHLFEW---------------RWVDIALECERYLAPKGFGGVQVSPPNENVAIHN- USR2:A 178/179 DDVIYEVHVRGFTEQDTSIPAQYRGTYYGAGLKAS-YLASLGVTAVEFLPVQETQNDAND

USR1:A 54/55 ------PFRPWWERYQPVSYKLCTRSG-------NEDEFRNMVTRCNNVGVRIYVDAVIN USR2:A 237/238 VVPNSDANQNYWGYMTENYFSPDRRYAYNKAAGGPTAEFQAMVQAFHNAGIKVYMDVVYN

USR1:A 101/102 HMCGN----------AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIEN USR2:A 297/298 HTAEGGTWTSSDPTTAT------------IYSWRG-----LDNATYYELTSGNQYFY---

USR1:A 151/152 YNDATQVRDCRLSGLLDLALGKDYVRSKIAEYMNHLID-IGVAGFRIDASKHMWP----- USR2:A 337/338 ---------DNTGIGANFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLASVLGNSCLNG

USR1:A 205/206 ----------------------GDIKAILDKLHNLNSNWFPEG-----SKPFIYQEVIDL USR2:A 388/389 AYTASAPNCPNGGYNFDAADSNVAINRILREFTV--------RPAAGGSGLDLFAEPWAI

USR1:A 238/239 GGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGW----GFMP----- USR2:A 440/441 GGNSYQLGGFPQGWSEWNGLFRDSLRQAQNELGSMT--IYVTQDANDFSGSSNLFQSSGR

USR1:A 289/290 -SDRALVFVDNHDNQ---------------------RGHGAGGASILTFWD--------- USR2:A 498/499 SPWNSINFIDVHDGMTLKDVYSCNGANNSQAWPYGPSDGGTSTNYSW---DQGMSAGTGA

USR1:A 318/319 ---ARLYKMAVGFMLAHPYGFTRVMSS----YRWPRYFENGKDVNDWVGPPNDNGVTKEV USR2:A 555/556 AVDQRRAARTGMAFEMLSAGTPLMQGGDEYLRTLQC------NNNAYNLDS---------

USR1:A 371/372 TINPDTTCGNDWVCEH--------RWRQIRNMVNFRNVVDGQ USR2:A 600/601 ---------SANWLTYSWTTDQSNFYTFAQRLIAFRKAHPAL
View Results:
Download alignment as a PDB file

Quick view of structure alignment (using Rasmol)

Detailed analysis of alignment (using Compare3D Java applet)

Notes: (i) On some platforms (IntermnetExplorer7) Compare3D starts from the second click (ii) Compare3D may not work with some versions of InternetExplorer or across the firewall

View of structure alignment using Protein Explorer