USR1:A(size=223) vs USR2:A(size=235)
Structure Alignment
Rmsd = 1.4Å Z-Score = 7.1
Sequence identity = 42.4%
Aligned/gap positions = 217/23

Sequence alignment based on structure alignment.
Sequence alignment based on structure alignment. Position numbers according to sequence (starting from 1) and according to PDB are given as SSSS/PPPP, SSSS - sequence, PPPP - PDB.

USR1:A - MOL_ID: 1; MOLECULE: BETA TRYPSIN; CHAIN: A; EC: 3.4.21.4

USR2:A - MOL_ID: 1; MOLECULE: TONIN; CHAIN: A; ENGINEERED: YES




USR1:A 1/17 IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG USR2:A 1/17 IVGGYKCEKNSQPWQVAVIN-EYLCGGVLIDPSWVITAAHCYSNNYQVLLGRNNLFKDEP

USR1:A 61/80 NEQFISASKSIVHPSYNS-----------NTLNNDIMLIKLKSAASLNSRVASISLPTSC USR2:A 60/80 FAQRRLVRQSFRHPDYIPLIVTNDTEQPVHDHSNDLMLLHLSEPADITGGVKVIDLPTKE

USR1:A 110/130 ASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQI-----TSNMFCAG USR2:A 120/131 PKVGSTCLASGWGSTNPSEMVVSHDLQCVNIHLLSNEKCI-----ETYKDNVTDVMLCAG

USR1:A 165/185 YLEGGKDSCQGDXGGPVVCSGKLQGIVSWGS-GCAQKNKPGVYTKVCNYVSWIKQTIASN USR2:A 175/186 EMEGGKDTCAGDSGGPLICDGVLQGITSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKEN
View Results:
Download alignment as a PDB file

Quick view of structure alignment (using Rasmol)

Detailed analysis of alignment (using Compare3D Java applet)

Notes: (i) On some platforms (IntermnetExplorer7) Compare3D starts from the second click (ii) Compare3D may not work with some versions of InternetExplorer or across the firewall

View of structure alignment using Protein Explorer