1PPR:M(size=312) vs 1GVK:B(size=240)
Structure Alignment
Rmsd = 8.2Å Z-Score = 1.2
Sequence identity = 6.7%
Aligned/gap positions = 104/146

Sequence alignment based on structure alignment.
Sequence alignment based on structure alignment. Position numbers according to sequence (starting from 1) and according to PDB are given as SSSS/PPPP, SSSS - sequence, PPPP - PDB.

1PPR:M - MOL_ID: 1; MOLECULE: PERIDININ-CHLOROPHYLL PROTEIN; CHAIN: M, N, O; SYNONYM: PCP

1GVK:B - MOL_ID: 1; MOLECULE: PEPTIDE INHIBITOR; SYNONYM: N-AC-NPI-CO2H; CHAIN: A; MOL_ID: 2; MOLECULE: ELASTASE 1; CHAIN: B; EC: 3.4.21.36




1PPR:M 33/34 GKLQPLEALKAIDKMIV---------------MGAAADPKLLKAAAEAHHKAIG------ 1GVK:B 2/18 VGGTEAQR-NSWPSQISLQYRSGSSWAHTCGGTLIRQN---WVMTAAHCVDRELTFRVVV

1PPR:M 72/73 ------------------------SISGPNGVTSRADWDNVNAALGRVIASVPENMVMDV 1GVK:B 58/70 GEHNLNQNNGTEQYVGVQKIVVHPY------WNTDDVAAGYDIALL----RLAQSVTLNS

1PPR:M 108/109 YDSVS------------------------------KITDPKVP----------------- 1GVK:B 108/118 YVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGST

1PPR:M 121/122 --------AYMKS-----------------------------LVNGA---DAEKAYEGFL 1GVK:B 168/177 VKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVS

1PPR:M 141/142 AFKDVVKKSQ 1GVK:B 228/234 AYISWINNVI
View Results:
Download alignment as a PDB file

Quick view of structure alignment (using Rasmol)

Detailed analysis of alignment (using Compare3D Java applet)

Notes: (i) On some platforms (IntermnetExplorer7) Compare3D starts from the second click (ii) Compare3D may not work with some versions of InternetExplorer or across the firewall

View of structure alignment using Protein Explorer