Gblocks 0.91b Results

Processed file: HBG444484_HOGENOM_O00622_query_querySeqNameChanged_twoGenewiseLampreysAdded_lightlyTrimmed.fasta
Number of sequences: 34
Alignment assumed to be: Protein
New number of positions: 76 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     --M-RWFLPWTLAAVTAAAASTVLATALSPAPTTMDFTPAPLED-----TSS--------
MOUSE15_70_PE1   --M-RWLLPWTLAAVAVLRVGNILATALSPTPTTMTFTPAPLEE-----TTT--------
CHICK2_151_PE14  --------------------------AIAQTSTTMTPTIPAAKE-----AYT--------
TETNG21_1_PE42   ---MSWLLLWILTAAGIQQVGTKASPASSHNLTAVPAVASAAPD-----AHS--------
DANRE16_31_PE15  ----------------MWRLLSWILLTSSLHQASFHNSTDSPPMTTELDPYN--------
DANRE20_1_PE8    --S-FWVRRAPLQAVYDAITTVLVSADLSESVLFLHALQGADSRREGTGPAD--------
CHICK3_71_PE3    --------------------CRAQAHRPQPRPGGKHPESSEAQP----------------
HS6_118_PE4      ------MNKRRLLYPSGWLHGPSDMQGLLFSTLLLAGLAQFCCRVQGTGPLDTTPEGRPG
MOUSE10_41_PE4   MRR-LLFCTLLMTGLTQQTKLCCRTQGSAPQDSTPGGRPGAALE-----VYQ--------
BRAFL_PE49250    ----------------MKVTQSSVAAVVVFLTCLVHALPEGKGG----------------
DANRE5_32_PE16   ----------------MSPLRIILRQGHFFTLVLLSWATAEVQG-----G----------
TETNG8_6_PE12    ----------------------MSERALFVLLFTAQVLTLAWSQ-----D----------
XENTR330_1_PE18  -------------------------MTPCLALCFILLLQQVASQ-----R----------
CHICK2_146_PE4   -------------------METGGGQGLPVLLLLLLLLRPCEAT-----VSG--------
HS8_125_PE3      ------------MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAAT-----QR---------
MOUSE15_57_PE3   ------------------MSLFLRKRCLCLGFLLFHLLSQVSAS-----LR---------
DANRE5_69_PE7    --------------------MTGTAFTRACIALSLLIHTAICQD----------------
XENTR200_2_PE6   --------------------MSAGKVTAVLLFALFCWVSDAQE-----------------
HS6_138_PE20     ----------------MTAASMGPVRVAFVVLLALCSRPAVGQN----------------
MOUSE10_26_PE4   -----------------MLASVAGPISLALVLLALCTRPAMGQD----------------
TETNG14_7_PE75   --------------------TISTKEEKMEKMLFLTFLSQAAAQ-----E----------
DANRE20_26_PE5   --------------------MFSGMTQSVIALLFLTFLRWAVAQ-----E----------
DANRE21_14_PE1   ----------------------MKMKDFMCLLVLVGIFCTSGGW-----G----------
DANRE23_45_PE13  ------------------------MFAWAVIVIFIAHFNMVSSS----------------
TETNG1_21_PE52   --------------------ITGDLFKMLMVTIAVLFIGSLNV-----------------
QUERY_HS1_91_PE  -------------------MSSRIARALALVVTLLHLTRLALST----------------
MOUSE3_149_PE17  -------------------MSSSTFRTLAVAVTLLHLTRLALST----------------
XENTR6_3_PE16    --------------------MSFLALNPILAVALLSGIIDLAVS-----S----------
XENTR48_3_PE12   ------------------MAMDPGILNRYLLLLGYCILPQICAQ----------------
CHICK20_6_PE35   --------------------MRLRLEKQLLILSLLCILSKVCSQ-----L----------
HS20_43_PE43     --------------------MRGTPKTHLLAFSLLCLLSKVRTQ-----L----------
MOUSE2_167_PE11  --------------------MRGNPLIHLLAISFLCILSMVYAQ-----L----------
Contig2.[132_85  ----------------------MARILVLCVVLIASLYQAACQQ----------------
Contig1.[344_83  -----------------------MASVLVISALLAVCVNLASSS----------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     -------RPQFCKWPC--ECPPSP-PRCPLGVSLITDGCEC-CKMCAQQLGDNCTEAAIC
MOUSE15_70_PE1   -------RPEFCKWPC--ECPQSP-PRCPLGVSLITDGCEC-CKICAQQLGDNCTEAAIC
CHICK2_151_PE14  -------RTQYCKWPC--ECPKSP-PRCSIGVSLVTDGCDC-CKMCAKQRGENCTEADTC
TETNG21_1_PE42   -------RTQYCKWPC--VCPDAP-PTCPPGVSLLVDGCDC-CKTCARQVGEGCDEAATC
DANRE16_31_PE15  -------RNRYCKWPC--KCPKSA-LVCPHGVSLLTDGCDC-CKACAKQAGETCNERDIC
DANRE20_1_PE8    -------KRQFCSWPC--KCGVR--PLCAPGVSSILDGCGC-CKTCAQQIGESCNERDIC
CHICK3_71_PE3    -------RTELCHWPC--QCPPV--PTCSPGVSLLKDGCGC-CKACAKQAGEVCNEVDIC
HS6_118_PE4      EVSDAPQRKQFCHWPC--KCPQQK-PRCPPGVSLVRDGCGC-CKICAKQPGEICNEADLC
MOUSE10_41_PE4   -------RTEVCRWPC--RCPPQR-PTCPPGVSLVRDGCGC-CKVCAKQPGDTCNEAEIC
BRAFL_PE49250    -----------CDGTC--ACPAQP-VTCVPGVRLLEDRCGCRCKVCASLLGEECSEMAPC
DANRE5_32_PE16   -----------CPLKC--SCPSTP-PSCPPGISSVLDHCGC-CRVCARQFNQDCSPTEPC
TETNG8_6_PE12    -----------CPRRC--QCPDEP-PTCPPAVPLILDDCAC-CLVCARQRGQACSDMSPC
XENTR330_1_PE18  -----------CPSQC-DQCPEEP-PSCAPSVPLVLDGCAC-CPVCARQEGESCSEMHPC
CHICK2_146_PE4   -------REAACPRPCGGRCPAEP-PRCAPGVPAVLDGCGC-CLVCARQRGESCSPLLPC
HS8_125_PE3      -----------CPPQCPGRCPATP-PTCAPGVRAVLDGCSC-CLVCARQRGESCSDLEPC
MOUSE15_57_PE3   -----------CPSRCPPKCPSIS-PTCAPGVRSVLDGCSC-CPVCARQRGESCSEMRPC
DANRE5_69_PE7    -----------CSQPC--DCPDES-PLCPVGTSLVLDGCSC-CKVCARQAGEPCSFLEPC
XENTR200_2_PE6   -----------CNGEC--QCPHKV-PVCDPGVSLVQDGCGC-CKVCAKQLGELCTERDVC
HS6_138_PE20     -----------CSGPC--RCPDEPAPRCPAGVSLVLDGCGC-CRVCAKQLGELCTERDPC
MOUSE10_26_PE4   -----------CSAQC--QCAAEAAPHCPAGVSLVLDGCGC-CRVCAKQLGELCTERDPC
TETNG14_7_PE75   -----------CGKPC--SCPSAP-PQCPPGVSLVLDGCGC-CRVCAKQMGELCTERDVC
DANRE20_26_PE5   -----------CSGQC--HCPEVP-PQCSPGVSLVLDTCGC-CRVCAKQLGELCTERDVC
DANRE21_14_PE1   -----------CPQVC--RCPVKR-PVCPAGVSAVPDACGC-CKVCAAQLNDDCHEGKPC
DANRE23_45_PE13  -----------CPAVC--SCAPDA-PQCPPGVGLQRDACGC-CLVCARQLNEDCSRSEPC
TETNG1_21_PE52   -----------CPAMC--ECPLEM-PHCAPGVSVVLDGCGC-CKVCARQLNEDCSLTEPC
QUERY_HS1_91_PE  -----------CPAAC--HCPLEA-PKCAPGVGLVRDGCGC-CKVCAKQLNEDCSKTQPC
MOUSE3_149_PE17  -----------CPAAC--HCPLEA-PKCAPGVGLVRDGCGC-CKVCAKQLNEDCSKTQPC
XENTR6_3_PE16    -----------CPAVC--QCPVEV-PKCAPGVGMVLDGCGC-CKVCAKQLNEDCSKTHPC
XENTR48_3_PE12   ----------LCRTPC--FCSWIP-PRCPPGVPVIVDGCGC-CRICARQLGESCDHLYLC
CHICK20_6_PE35   -----------CRRPC--YCSQML-PRCPRGSPLVLDGCGC-CRICARRLGEPCDFLHVC
HS20_43_PE43     -----------CPTPC--TCPWPP-PRCPLGVPLVLDGCGC-CRVCARRLGEPCDQLHVC
MOUSE2_167_PE11  -----------CPAPC--ACPWTP-PQCPPGVPLVLDGCGC-CRVCARRLGESCDHLHVC
Contig2.[132_85  -----------CSNVC--RCPKGP-PVCPVGVSLVADGCGC-CKVCAKQLGDVCTEADSC
Contig1.[344_83  -----------CPAQCP-QCPASL-PQCALGVSLVNDGCGC-CKVCARQFNQDCSRSEPC
                                          ################ ##################


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     DPHRGLYCDYSGDRPRYAI-GVCAQV-VGVGCVLDGVRYNNGQSFQPNCKYNCTCIDGAV
MOUSE15_70_PE1   DPHRGLYCDYSGDRPRYAI-GVCAQV-VGVGCVLDGVRYTNGESFQPNCRYNCTCIDGTV
CHICK2_151_PE14  DFHRGLYCDYSGDRPRYEI-GVCSQI-VGVGCVLNGVRYNNGDTFQPNCKYNCTCINGAV
TETNG21_1_PE42   DHHRGLYCDYSADKPRYEK-GVCAYM-AGSGCEHDGVIYRNGQSFAPSCKYQCVCVNGAI
DANRE16_31_PE15  DYHKGLYCDYSADKPRYEK-GVCAYV-MGTGCEYNGVIYRNGQSFQPNCKYRCLCVNGAI
DANRE20_1_PE8    DPHKSMYCDFSKDQPRYEV-GICAYL-MGVGCDLNGAHYDNGQAFQPNPLYKCTCISGSI
CHICK3_71_PE3    DPHKGLYCDYSQDEPRYET-GVCAYL-VAVGCELNGIYYLNGQNFQPNPLYKCLCISGAI
HS6_118_PE4      DPHKGLYCDYSVDRPRYET-GVCAYL-VAVGCEFNQVHYHNGQVFQPNPLFSCLCVSGAI
MOUSE10_41_PE4   DPHKGLYCDYSGDTPRYET-GVCAYL-VAVGCEFNRVYYQNGQVFQPHPLFSCLCVSGAI
BRAFL_PE49250    DDTVGLYCDYSADKPT----GICKAT-FQTPCVFQGKVYQSGESFELSCRETCVCQNGAV
DANRE5_32_PE16   DHIKGLRCHLGAE-GDPDR-GLCRAEAQGRPCELDGRIYQHGEDFQPSCEHQCTCVDGVV
TETNG8_6_PE12    DTRKGLRCDYAKD-VRKRT-GLCVAH-GGHVCVLDGSVYQNGQTFIPSCKYQCMCWDGQI
XENTR330_1_PE18  QEDKGLYCEFNAD-PRTEA-GICMAL-EGNNCIFDGVVYRNRATFQPSCKYHCTCLNGHI
CHICK2_146_PE4   DESGGLYCDRGPE-DGGGA-GICMVL-EGDNCVFDGMIYRNGETFQPSCKYQCTCRDGQI
HS8_125_PE3      DESSGLYCDRSAD-PSNQT-GICTAV-EGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQI
MOUSE15_57_PE3   DQSSGLYCDRSAD-PNNQT-GICMVP-EGDNCVFDGVIYRNGEKFEPNCQYFCTCRDGQI
DANRE5_69_PE7    DHHKGLYCDYSVL-SDTET-GICMAQ-EGQTCDLGGVIYRSGETFQPSCKHQCVCMNGEI
XENTR200_2_PE6   DPHKGLFCDFGSR-VNRKI-GVCTAR-EGAPCVFGGTVYRSGESFQSSCKYQCTCIDGGV
HS6_138_PE20     DPHKGLFCHFGSP-ANRKI-GVCTAK-DGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAV
MOUSE10_26_PE4   DPHKGLFCDFGSP-ANRKI-GVCTAK-DGAPCVFGGSVYRSGESFQSSCKYQCTCLDGAV
TETNG14_7_PE75   DPHKGLYCDFGAR-INRRI-GVCTAR-DGATCVFGGAVYKSGETFQSSCKYQCTCLDGAM
DANRE20_26_PE5   DPHKGLYCDYGSP-SNRRI-GVCTAR-DGATCVFGGMVYRSGESFQSSCKYQCTCLDGAV
DANRE21_14_PE1   DHHKGLECNYGND-VSSLH-GICRAKLEGRSCEYNGRMYQNGENFRAGCKHQCTCIDGAV
DANRE23_45_PE13  DHSKGLECNYGAS-HGATR-GICRAKSEGRPCEYSSRIYQNGESFQPNCKHQCTCMDGAV
TETNG1_21_PE52   DHTKGLECNFGASFAGATTRGICRAKSEGRPCEYSSRIYQNGESFQPNCKHQCTCIDGAV
QUERY_HS1_91_PE  DHTKGLECNFGAS-STALK-GICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV
MOUSE3_149_PE17  DHTKGLECNFGAS-STALK-GICRAQSEGRPCEYNSRIYQNGESFQPNCKHQCTCIDGAV
XENTR6_3_PE16    DHTKGLECNFGAS-SRAIK-GICRAKSEGRPCEYNSKIYQNGESFQPNCKHQCTCIDGAV
XENTR48_3_PE12   DESKELLCDYPTGSNGR---GTCNYNYDG-SCEYDGKEYKDGEVFQPNCKFQCKCIDGGI
CHICK20_6_PE35   DRSQGLICDYSSGTG-----GTCNFEDNEEGCEVNGRLYRDGEVFQPSCKLQCRCLDGGF
HS20_43_PE43     DASQGLVCQPGAG-PGGRG-ALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGF
MOUSE2_167_PE11  DPSQGLVCQPGAG-PSGRG-AVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGF
Contig2.[132_85  DPHRGLYCAFSTDLQIRIG--VCSAR-DGVPCELGGTMYLNGESFEPSCKYRCTCVDGAI
Contig1.[344_83  DPLKGLECDSGAD-AAAER-GICRAKSEGRTCDYNGKIYQHGESFQPNCKHACTCVDGVV
                 ########                       #############################


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     GCTPLC-LRVRPPRL---WCPHP--RRVSIPGHCCEQWVCED--DAKRPRKTAPRDTGA-
MOUSE15_70_PE1   GCTPLC-LSPRPPRL---WCRQP--RHVRVPGQCCEQWVCDD--DARRPRQTALLDTRA-
CHICK2_151_PE14  GCIPMC-TNSRPPLV---WCPNP--KLIKMAGKCCEQWVCDD--SK---KIRKTSPRHI-
TETNG21_1_PE42   GCVGLCAESQPPPRV---WCQAP--RRVKVPGQCCERWICDE--AR---RGRKTAPRHA-
DANRE16_31_PE15  GCVPLC-TDSLPPRV---WCQSP--KRVKIPGQCCEKWICEE--SR---KPRKTNPRHA-
DANRE20_1_PE8    GCTPA--FIQKPTGM---LSPAA--LQGQLPAG-----LKSS--RNPKNQQDTTYRTMS-
CHICK3_71_PE3    GCTPI--FTPKLAAS---PCSSG--MGRKKNGQT----VCGP--GQNKQLQSVNYRLMS-
HS6_118_PE4      GCTPL--FIPKLAGS---HCSGA------KGGKKSDQSNCSL--EPLLQQLSTSYKTMP-
MOUSE10_41_PE4   GCTPL--FIPKLAGS---NCSAAKGRRKTDPPNCGR--------GTLQQQNSASYKTMS-
BRAFL_PE49250    GCMPLCPQEVRMPSD---DCPFP--QLEKVPGKCCKQWMCDA--KPKELSAKGPMPMIAG
DANRE5_32_PE16   GCLPLCPHHISLPDW---RCARR--RLIRKPERCCPEWVCDD--DNRIAEVNPVPEAHPA
TETNG8_6_PE12    TCVPRCNLDMMLPGP---DCPMP--RRVQVPGECCEKWVCDP--QAE--ASALGGFAMA-
XENTR330_1_PE18  GCVPRCNLDLMLPGP---DCPFP--RRVKVPGECCEKWVCDS--KE---EMAIGGFAMA-
CHICK2_146_PE4   GCLPRCNLGLLLPGP---DCPFP--RKIEVPGECCEKWVCDP--RD---EVLLGGFAMA-
HS8_125_PE3      GCVPRCQLDVLLPEP---NCPAP--RKVEVPGECCEKWICGP--DE---EDSLGGLTLA-
MOUSE15_57_PE3   GCLPRCQLDVLLPGP---DCPAP--RKVAVPGECCEKWTCGS--DEQGTQGTLGGLALP-
DANRE5_69_PE7    GCVPTCATIIRLPSP---DCPYP--RRVQIPGKCCEEWVCDQIPQEDTFQSAVAGRSIG-
XENTR200_2_PE6   GCVPLCSMDIRLPSP---ECPFP--RRVKLPGKCCEEWVCDQ--PQ---ERTLVGPALP-
HS6_138_PE20     GCMPLCSMDVRLPSP---DCPFP--RRVKLPGKCCEEWVCDE--PK---DQTVVGPALA-
MOUSE10_26_PE4   GCVPLCSMDVRLPSP---DCPFP--RRVKLPGKCCEEWVCDE--PK---DRTAVGPALA-
TETNG14_7_PE75   GCVPLCSVNVRLPSP---DCPMP--RRVKVPGKCCEEWECDS--PN---KNSFVGSALA-
DANRE20_26_PE5   GCVPLCGMDIRLPSP---DCPMP--RRVKVPGKCCEEWVCDS--PR---QNTFVGSALA-
DANRE21_14_PE1   GCVPLCPTDIPLSSP---SCPKP--RLVKIPGQCCLSLDCHG--ESPVLPPVFRRPQPP-
DANRE23_45_PE13  GCVPLCPQELSLPAL---GCANP--RLVKVPGRCCEEWVCDD--EQQGGKLIESANKMPG
TETNG1_21_PE52   GCVPLCPQELSLPNL---GCANP--RLVKVAGQCCEEWVCDD--GKQTDVLERIFGKDV-
QUERY_HS1_91_PE  GCIPLCPQELSLPNL---GCPNP--RLVKVTGQCCEEWVCDE--DSIKDPMEDQDGLLG-
MOUSE3_149_PE17  GCIPLCPQELSLPNL---GCPNP--RLVKVSGQCCEEWVCDE--DSIKDSLDDQDDLLG-
XENTR6_3_PE16    GCLPLCPQELSLPNL---GCPNP--RLVKVPGQCCEEWVCDE--AKDPVDEIVDFFNKE-
XENTR48_3_PE12   TCTPLCSENVLIATP---ECPFP--RRVEIPGRCCPEWICDE--DQQSPVSNSLGKERE-
CHICK20_6_PE35   TCVPLCQEDVRLPTP---DCPHP--RRVDIPGKCCPEWVCEA--GERHLLQSTGAGNTG-
HS20_43_PE43     TCVPLCSEDVRLPSW---DCPHP--RRVEVLGKCCPEWVCGQ-------GGGLGTQPLP-
MOUSE2_167_PE11  TCLPLCSEDVRLPSW---DCPRP--RRIQVPGRCCPEWVCDQ--AVMQPAIQPSSAQGH-
Contig2.[132_85  GCVPLCAQDVRLPSA---DCPHP--RHVKLPGKCCEEWVCDG--RKEPNSTPLGGFALP-
Contig1.[344_83  GCMPLCPQELAFPAARLAGCANP--RLVKVPGRCCEEWTCDD------------------
                 #####                                                       


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     ----FDAVGEVEAWHR---------------------------------NCIAYTSPWSP
MOUSE15_70_PE1   ----FAASGAVEQRYE---------------------------------NCIAYTSPWSP
CHICK2_151_PE14  --SSAAYEGEDEAWQK---------------------------------NCIVHTSPWSP
TETNG21_1_PE42   ---IEAAPAETRSWHR---------------------------------NCIPQTSSWSP
DANRE16_31_PE15  ----PAEVSANDIWHN---------------------------------NCIAQTTPWSP
DANRE20_1_PE8    ------------AWKK---------------------------------NCLVQTTAWSP
CHICK3_71_PE3    -----AYRNLPLVLKK---------------------------------KCLVQATPWTP
HS6_118_PE4      -----AYRNLPLIWKK---------------------------------KCLVQATKWTP
MOUSE10_41_PE4   -----AYRNLPLTWRK---------------------------------KCLVQATKWTP
BRAFL_PE49250    KLERKPETEYPEPV-----------------------------------ACLLQATSWSQ
DANRE5_32_PE16   EHTHLTGNELLVTPSASWDSSAGAPYQEWISSSKSRPIAPA--------TCLLQITDWSP
TETNG8_6_PE12    -AYRQEETVRFDAWDSSL-------------------------------NCIEQTTEWGA
XENTR330_1_PE18  -AYRPEATLGIDASDMF--------------------------------TCIAQTTEWSA
CHICK2_146_PE4   -AYRQEATLGIDVSDSSA-------------------------------NCIEQTTEWSA
HS8_125_PE3      -AYRPEATLGVEVSDSSV-------------------------------NCIEQTTEWTA
MOUSE15_57_PE3   -AYRPEATVGVEVSDSSI-------------------------------NCIEQTTEWSA
DANRE5_69_PE7    -KEISAHGLQPESARD---------------------------------NCIVQTTEWSE
XENTR200_2_PE6   -AFRMEETYGPDPSLIRA-------------------------------NCLVQTTEWSA
HS6_138_PE20     -AYRLEDTFGPDPTMIRA-------------------------------NCLVQTTEWSA
MOUSE10_26_PE4   -AYRLEDTFGPDPTMMRA-------------------------------NCLVQTTEWSA
TETNG14_7_PE75   -AYREEETFGPDLSMMRE-------------------------------NCLVQTTEWSA
DANRE20_26_PE5   -AYREEETYGPDPSMMRE-------------------------------NCLVQTTEWSA
DANRE21_14_PE1   -PFLLPDPHTFKKPPAKPKYSLSNELMEVEKRWDKPRSRK---------HLPAQTTSWTS
DANRE23_45_PE13  NKEVGGDSEKELTNKNELISVIMNTKLKSLPAFRSHQME----------KCIVQTTGWSQ
TETNG1_21_PE52   ---LTDELERDLTNKNELISVVNGGGLKSLAAFRPQPEVQL--FD--NHKCIVQTTPWSQ
QUERY_HS1_91_PE  KELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQ--GQKCIVQTTSWSQ
MOUSE3_149_PE17  ----LDASEVELTRNNELIAIGKGSSLKRLPVFGTEPRVLFNPLHAHGQKCIVQTTSWSQ
XENTR6_3_PE16    --FGMDTSEGELTRKNEFVAVVKG-GLKMLPVFGSDPQSHV--VE--NSKCIVQTTSWSQ
XENTR48_3_PE12   ------AKGRSQVKPF---------------------------------ACAEWSTQWST
CHICK20_6_PE35   -LQSLSPLLCFHPARAVPY------------------------------PCQPWGTEWSA
HS20_43_PE43     -AQGPQFSGLVSSLPPGV-------------------------------PCPEWSTAWGP
MOUSE2_167_PE11  ---QLSALVTPASADG---------------------------------PCPNWSTAWGP
Contig2.[132_85  -AYRQEETYGPDPESVRD-------------------------------NCIVQTTEWSA
Contig1.[344_83  ------------------------------------------------------------
                                                                             


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     CSTSCGLGVSTRISNVNAQCWPEQESRLCNLRPCDVDI-HTLIK-------------AGK
MOUSE15_70_PE1   CSTTCGLGISTRISNVNARCWPEQESRLCNLRPCDVDI-QLHIK-------------AGK
CHICK2_151_PE14  CSKTCGLGISTRISNDNDQCRLLKESRLCNMRPCEVDI-TKHIK-------------PGK
TETNG21_1_PE42   CSRSCGRGLSLRVSNANERCELVKESRLCNLRPCEVNI-TGYIK-------------PGK
DANRE16_31_PE15  CSKTCGRGISLRISNENAGCVMEKESRLCNLRPCEVDI-TKHFR-------------PGK
DANRE20_1_PE8    CSRSCGIGISVRVNNDNSKCEMRKERRLCLLRPCDKNT-LKRLKMP-----------KGK
CHICK3_71_PE3    CSRTCGIGISSRVTNENKKCEMKKEKRLCFIQPCLTNI-LKTVKIP-----------KGK
HS6_118_PE4      CSRTCGMGISNRVTNENSNCEMRKEKRLCYIQPCDSNI-LKTIKIP-----------KGK
MOUSE10_41_PE4   CSRTCGMGISNRVTNDNANCEMRKERRLCYIQPCSRNT-SQAVKIP-----------RGE
BRAFL_PE49250    CSVTCGMGVSTRVSNHNPECRMQVEKRICQMRPCDLQY-LNHIKVRTSLFIKSRGGWDGK
DANRE5_32_PE16   CSATCGIGVSSRVTNSNPECRLVSETRLCQIRECGVNT-APSMK-------------KGK
TETNG8_6_PE12    CSQTCGVGVSTRVTNKNRRCEMVKQTRLCMIRPCADQL-DRTRL-------------RGS
XENTR330_1_PE18  CSKTCGMGVSSRVTNRNPRCEMQKQIRLCMVRPCEEEPGWHMEK-------------KGK
CHICK2_146_PE4   CSKSCGMGFSTRVTNRNQQCEMVKQTRLCMMRPCENE--EPSDK-------------KGK
HS8_125_PE3      CSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDK-------------KGK
MOUSE15_57_PE3   CSKSCGMGVSTRVTNRNRQCEMVKQTRLCIVRPCEQEPEEVTDK-------------KGK
DANRE5_69_PE7    CSATCGMGVSSRVTNDNEQCQLERQTRMCMIRPCHADL-EKDIK-------------RGK
XENTR200_2_PE6   CSKTCGMGISTRVTNDNEHCRLEKQSRLCMVRPCEADL-EENIK-------------KGK
HS6_138_PE20     CSKTCGMGISTRVTNDNASCRLEKQSRLCMVRPCEADL-EENIK-------------KGK
MOUSE10_26_PE4   CSKTCGMGISTRVTNDNTFCRLEKQSRLCMVRPCEADL-EENIK-------------KGK
TETNG14_7_PE75   CSKSCGLGISTRVTNDNRECRLEKQTRLCMVRPCESQL-EQSIR-------------KGK
DANRE20_26_PE5   CSKTCGLGISTRVTNDNRECRLEKQSRLCMVRPCESHL-EEKIR-------------KGK
DANRE21_14_PE1   CSRSCGMGVSSRVTNENRQCKLMKETRLCNIRPCSSA--AVPIK-------------KGR
DANRE23_45_PE13  CSRSCGTGISTRITNNNAECKLMKESRICEVRPCSQSP-HTSLK-------------KGK
TETNG1_21_PE52   CSKSCGTGISTRVTNHNSECKLVKETRLCEVRPCTQSP-YSSLK-------------KGK
QUERY_HS1_91_PE  CSKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPV-YSSLK-------------KGK
MOUSE3_149_PE17  CSKSCGTGISTRVTNDNPECRLVKETRICEVRPCGQPV-YSSLK-------------KGK
XENTR6_3_PE16    CSKTCGTGISTRVTNDNSNCRLVRETRICEVRPCGQPS-YTSLK-------------KGK
XENTR48_3_PE12   CSVSCGVGLSLRVSNRNPLCRLKAQTRLCMVRPCR----YSPAT-------------EGV
CHICK20_6_PE35   CSATCGVGFSTRVSNQNPYCRLETQRRLCVLRPC--------------------------
HS20_43_PE43     CSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCP-------------------------
MOUSE2_167_PE11  CSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCL-------------------------
Contig2.[132_85  CSHTCGLGVSSRVTNENRQCRLERQTRLCTVRPCDVPL----------------------
Contig1.[344_83  ------------------------------------------------------------
                                                                             


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
HS8_139_PE19     KCLAVYQPEASMNFTLA----GCISTRSYQPKYCGVCM-DNRCCIPYKSKTIDVSFQCPD
MOUSE15_70_PE1   KCLAVYQPEEATNFTLA----GCVSTRTYRPKYCGVCT-DNRCCIPYKSKTISVDFQCPE
CHICK2_151_PE14  KCLAVYRTNEPMNYTIS----GCMSKSPYRPKYCGICT-DNRCCTPYKSKTIEVRFECPD
TETNG21_1_PE42   KCLNIYREELPSNLTIS----GCTSKRPYRPKYCGVCT-DERCCIPYKSRTVEVEFQCPN
DANRE16_31_PE15  KCLNIYREPEFQNFTIS----GCVSKKPYWPKYCGVCT-DERCCIPYKSKTIEVEFECPD
DANRE20_1_PE8    TCKPKFQASKAEKLSLS----GCTSVKKHRPTYCGVCT-DKRCCVPNKSKMVNVEFHCKG
CHICK3_71_PE3    TCQPTFQLPRAEKLFFS----GCSTTQSYKLTFCGVCV-DKRCCVPNKSKMITLQFECPN
HS6_118_PE4      TCQPTFQLSKAEKFVFS----GCSSTQSYKPTFCGICL-DKRCCIPNKSKMITIQFDCPN
MOUSE10_41_PE4   TCQPTFQLPKAEKFVFS----GCSSTQSYRPTFCGICL-DKRCCVPNKSKMITVRFDCPS
BRAFL_PE49250    KCRSTIRSMEPSKITFSWYNTRCTTVKAYKWRWCGGCTISGRCCTPYKVKTTTMDFICED
DANRE5_32_PE16   KCERSTRPQKPVQISFA----GCSTTRRYRLRSCGFCS-DGRLCVPSATRTVRLHFHCPE
TETNG8_6_PE12    KCQRVVRSGTAVRLSHK----NCTSIQAYTPRYCGSCT-DGRCCTPHRTKTALVDFQCTN
XENTR330_1_PE18  RCVRMRKTTKPIHLHYK----NCSSVQPYKPKFCGQCS-DGRCCTPHTTKTMHVEFECPQ
CHICK2_146_PE4   KCIRTKKSMKAVRFEYK----NCTSVQTYKPRYCGLCN-DGRCCTPHNTKTIQVEFRCPQ
HS8_125_PE3      KCLRTKKSLKAIHLQFK----NCTSLHTYKPRFCGVCS-DGRCCTPHNTKTIQAEFQCSP
MOUSE15_57_PE3   KCLRTKKSLKAIHLQFE----NCTSLYTYKPRFCGVCS-DGRCCTPHNTKTIQVEFQCLP
DANRE5_69_PE7    KCVRTPKSQSGMRFELS----GCQSIRLYKPKFCGVCT-DDRCCTPQSTITAEVEFRCPE
XENTR200_2_PE6   KCIRTPKISKPVKFEIS----GCTSVKTYRAKFCGVCT-DGRCCTPHRTATLPVEFKCPD
HS6_138_PE20     KCIRTPKISKPIKFELS----GCTSMKTYRAKFCGVCT-DGRCCTPHRTTTLPVEFKCPD
MOUSE10_26_PE4   KCIRTPKIAKPVKFELS----GCTSVKTYRAKFCGVCT-DGRCCTPHRTTTLPVEFKCPD
TETNG14_7_PE75   KCIRTPRVSKPMKFEIS----GCTTTKSYRPKFCGVCL-DGRCCTPHRTTTLPMEFKCPD
DANRE20_26_PE5   KCIRTPRVSKPMKFEIS----GCTTTKSYRPKFCGVCT-DGRCCTPHRTATLPMEFKCPD
DANRE21_14_PE1   KCSRTQKSPEPLRLRYA----GCRSTRLYRPNYCGMCL-DGRCCSPRRTRTVPVLFSCPT
DANRE23_45_PE13  KCNRTKKSVTPVKFSYA----GCSSLKKYRPRFCGSCV-DGRCCSPQNTRTIRVKFRCQD
TETNG1_21_PE52   KCSRTKKSSQPVKFTYA----GCSSLKKYRPKYCGACV-DGRCCSPHVTRTIRVKFRCED
QUERY_HS1_91_PE  KCSKTKKSPEPVRFTYA----GCLSVKKYRPKYCGSCV-DGRCCTPQLTRTVKMRFRCED
MOUSE3_149_PE17  KCSKTKKSPEPVRFTYA----GCSSVKKYRPKYCGSCV-DGRCCTPLQTRTVKMRFRCED
XENTR6_3_PE16    KCTKTKKSQAPVRYTYA----GCSSVKKYRPKYCGSCV-DGRCCTPQQTRTVKIRFRCED
XENTR48_3_PE12   TCTPTVHSALRLRYKTD----DCISIREFRPTFCGTC--PMKHCAPYQTENDLVAFHCRG
CHICK20_6_PE35   -------PALPA-------------------------------ASP----------AVSD
HS20_43_PE43     ---------------------------------------PSRGRSPQNSA-----F----
MOUSE2_167_PE11  ---------------------------------------ASRSHGSWNSA-----F----
Contig2.[132_85  ------------------------------------------------------------
Contig1.[344_83  ------------------------------------------------------------
                                                                             


                        430       440       450       460       470
                 =========+=========+=========+=========+=========+=
HS8_139_PE19     GLG--FSRQVLWINACFCNLSCRN-----PNDIF---ADLESYPDFSEIAN
MOUSE15_70_PE1   GPG--FSRQVLWINACFCNLSCRN-----PNDIF---ADLESYPDFEEIAN
CHICK2_151_PE14  GTE--ISWKIMWINACFCNLNCKN-----PNDIF---ADLAHYHDYSEIAN
TETNG21_1_PE42   GTG--FSWKMLWIQACFCNLSCRN-----PNDIF---TELDSYYGYSEIVN
DANRE16_31_PE15  GAL--LTWKYMWINACFCNLSCRN-----PNDIF---ADLEQYYEFNEIVN
DANRE20_1_PE8    GSN--VRWKMQWITSCVCQRKCSN-----ADDMF---SELHLI--------
CHICK3_71_PE3    EGF--FKWKMMWITSCVCQRICSD-----PGDIF---SELKIL--------
HS6_118_PE4      EGS--FKWKMLWITSCVCQRNCRE-----PGDIF---SELKIL--------
MOUSE10_41_PE4   EGS--FKWQMLWVTSCVCQRDCRE-----PGDIF---SELRIL--------
BRAFL_PE49250    RTP--IKQDVAWIHSCTCHRNCPL-----A---------------------
DANRE5_32_PE16   AERHDFTRSLMWIQRCSCRHTHSRRGLNTPAELF------NLPNDIHTYTH
TETNG8_6_PE12    GKS--ARRPVMVILTCVCHTHCPR-----DNAVW-----------------
XENTR330_1_PE18  KRI--IKKPVMVVSTCVCHYNCPR-----DASLL--QVDNARFPGLNTNL-
CHICK2_146_PE4   GKF--LKKPMMLINTCVCHGNCPQ-----SNNAF--FQPLDPMSSEAKI--
HS8_125_PE3      GQI--VKKPVMVIGTCTCHTNCPK-----NNEAF--LQELELKTTRGKM--
MOUSE15_57_PE3   GEI--IKKPVMVIGTCTCYSNCPQ-----NNEAF--LQDLELKTSRGEI--
DANRE5_69_PE7    GDS--FRKKMMFIKTCSCHHNCPR-----ENDIFLASNSRRMIGDYENDM-
XENTR200_2_PE6   GEI--MKKNMMFIKTCACHSNCPG-----DNDIFEAMYYRKMYGDMA----
HS6_138_PE20     GEV--MKKNMMFIKTCACHYNCPG-----DNDIFESLYYRKMYGDMA----
MOUSE10_26_PE4   GEI--MKKNMMFIKTCACHYNCPG-----DNDIFESLYYRKMYGDMA----
TETNG14_7_PE75   GQV--MKKHMMFIKSCACHYNCPG-----ENDIFESMYYKKMVGDMA----
DANRE20_26_PE5   GQV--MKKQMMFIKTCACHYNCPG-----ENDIFESMYYKKMVGDMA----
DANRE21_14_PE1   GER--FERAVMFVQSCKCNDDCGS-----LNDAS-LPPQRWLYGDMHKFID
DANRE23_45_PE13  GET--FNKNVMMIESCKCTKHCPH-----ASEAG--FPFYRLYNDIHKFTD
TETNG1_21_PE52   GET--FNKNIMVIESCKCTYNCPH-----VNEAS--YPFYRLSNDIHKFRD
QUERY_HS1_91_PE  GET--FSKNVMMIQSCKCNYNCPH-----ANEAA--FPFYRLFNDIHKFRD
MOUSE3_149_PE17  GEM--FSKNVMMIQSCKCNYNCPH-----PNEAS--FRLYSLFNDIHKFRD
XENTR6_3_PE16    GET--FTKNVMMIQSCRCNYNCPH-----ANEAY---PYYRLFNDIHKFRD
XENTR48_3_PE12   GLT---WKQMMSIISCVCY--------------------------------
CHICK20_6_PE35   G--------------------------------------------------
HS20_43_PE43     ---------------------------------------------------
MOUSE2_167_PE11  ---------------------------------------------------
Contig2.[132_85  ---------------------------------------------------
Contig1.[344_83  ---------------------------------------------------
                                                                    






Parameters used Minimum Number Of Sequences For A Conserved Position: 18 Minimum Number Of Sequences For A Flanking Position: 28 Maximum Number Of Contiguous Nonconserved Positions: 8 Minimum Length Of A Block: 10 Allowed Gap Positions: None Use Similarity Matrices: Yes
Flank positions of the 3 selected block(s)
Flanks: [86  101]  [103  128]  [152  185]  

New number of positions in HBG444484_HOGENOM_O00622_query_querySeqNameChanged_twoGenewiseLampreysAdded_lightlyTrimmed.fasta-gb:  76  (16% of the original 471 positions)





Resulting alignment

Generated by Gblocks Server