USR1:B(size=157) vs USR2:A(size=138)
Structure Alignment
Rmsd = 2.8 Z-Score = 5.6
Sequence identity = 14.8%
Aligned/gap positions = 128/20

Sequence alignment based on structure alignment.
Sequence alignment based on structure alignment. Position numbers according to sequence (starting from 1) and according to PDB are given as SSSS/PPPP, SSSS - sequence, PPPP - PDB.

USR1:B - MOL_ID: 1; MOLECULE: PROTEIN (CHAPERONE PROTEIN PAPD); CHAIN: A; MOL_ID: 2; MOLECULE: PROTEIN (PROTEIN PAPK); CHAIN: B

USR2:A - MOL_ID: 1; MOLECULE: MATURE FIMBRIAL PROTEIN PAPE; CHAIN: A, C; FRAGMENT: RESIDUE 25-173, RESIDUE 26-36 DELETED; ENGINEERED: YES; MUTATION: YES; MOL_ID: 2; MOLECULE: PEPTIDE CORRESPONDING TO THE N-TERMINAL EXTENSION OF PROTEIN PAPK; CHAIN: B, D; FRAGMENT: RESIDUE 22-32; ENGINEERED: YES




USR1:B 13/14 PCHVSGDSLNKHVVFKTRASRDFWYPPGRSPTESFVIRLENCHATAVGKIVTLTFKGTEE USR2:A 2/14 PACT---VSNTTVDWQDVEIQTL-SQNGNHEKEFTVNXRCPYNLGTX----KVTITATNT

USR1:B 73/74 AALPGHLKVTGVN---AGRLGIALLDTD---GSSLLKPGTSHNKGQGEKVTGNSLELPFG USR2:A 54/66 Y--NNAILVQNTSNTSSDGLLVYLYNSNAGNIGTAITLGTPF-TPGKITGNNADKTISLH

USR1:B 127/128 AYVVATPEALRTKSVVPGDYEATATFEL USR2:A 111/123 AKLGYKGNX---QNLIAGPFSATATLVA
View Results:
Download alignment as a PDB file

Quick view of structure alignment (using Rasmol)

Detailed analysis of alignment (using Compare3D Java applet)

Notes: (i) On some platforms (IntermnetExplorer7) Compare3D starts from the second click (ii) Compare3D may not work with some versions of InternetExplorer or across the firewall

View of structure alignment using Protein Explorer