Gblocks 0.91b Results

Processed file: pasted_alignment
Number of sequences: 52
Alignment assumed to be: Protein
New number of positions: 253 (selected positions are underlined in blue)

                         10        20        30        40        50        60
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  -----MPAYYPNLALSSSLKRIVGFSIFKMVAAVTFLGVLTFLLLSNDASTNTD------
XP_002123273_1_  --------------------------MKSVLLQTAVLLVGCILDKC--------------
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  ------------------------MNGAIIAICLTLLPVLI-------------------
BRAFL_AMPHIOXUS  ------------------------------------------------------------
BRAFL_XP_002212  -------------------------MPRTVPSVPMLFSTFV-------------------
TELEOST_FUNHE_A  ------------------------------------------------------------
TETNI_CAF95578   -----------------------------------LVSDAFLS-----------------
TELEOST_FUNHE_A  ---------------------------MRASVLGSVCALLVLL-----------------
TELEOST_MYOOC_A  ---------------------------MRSPVLGPVCALLLLL-----------------
TELEOST_MICUN_B  ---------------------------MRSSVLGSVWALLLLL-----------------
DANRE_AAI16576.  ---------------------------MRECNFLLKWTVILLL-----------------
DANRE_NP_705942  ---------------------------MRECNFLLKWTVILLL-----------------
SALFA_TELEOST_A  ---------------------------MRGL-VVCVWACILLQ-----------------
TELEOST_SALSA_N  ---------------------------MREC-VVCVWACILLQ-----------------
TELEOST_ONCMY_N  MSAAYIIFALLYWEDAPAEGAYAVNLTMREC-VVWVWACILLQ-----------------
XENLA_AAI70301.  ---------------------------MAGLCLTMLFMIVTSSYSLEVS-----------
XENLA_NP_001091  ---------------------------MAGLCLTMLFMIVTSSYSLEVS-----------
CHICK_XP_425326  -----------------MEGLQSGAGGRSSVSHTCGHPAGFLLGVEVAVARQDTLTAPWL
PGH1_MOUSE       -------------------------MSRRSLSLW--FPLLLLL---------------L-
PGH1_RAT         -------------------------MSRRSLSLQ--FPLLLLL---------------L-
PGH1_RABIT       -------------------------MSRSSPSLR--LPVLLLL---------------LL
PGH1_HUMAN       -------------------------MSR-SLLLR--FLLFLLL---------------L-
PGH1_SHEEP       -------------------------MSRQSISLR--FPLLLLL---------------L-
PGH1_BOVIN       -------------------------MSRQGISLR--FPLLLLL---------------L-
SHARK_SQUAC_AAL  ---------------------------MEAARIILLLLPLCFLKMADT------------
HAGFISH_MYXGL_A  ---------------------------MTSEVFVVLCVAVVFAG--AA------------
DANRE_NP_705943  ---------------------------MNKLVCLVLLSSIWIFP-GEG------------
DANRE_AAH63232.  ---------------------------MNKLVCLVLLSSIWIFP-GEG------------
DANRE_NP_001020  ----------------------------MKSSVLFIFLLLGFVV-CTG------------
TETNI_CAG11618.  ------------------------------------------------------------
TELEOST_DICLA_C  ---------------------------MQLVLVLLLAASLIPT-----------------
TELEOST_ONCMY_N  -------------------------MNRVICIILLLAVGLYFC-----------------
SALFO_TELEOST_A  -------------------------MNKVVCIILLLTVGLYFC-----------------
TELEOST_ONCMY_N  ---------------------------MNRIISALLFLPLGIIFVCEG------------
TELEOST_FUNHE_A  ---------------------------MNRITFAVFLLALCFSF-HKE------------
TELEOST_MICUN_B  ---------------------------MNKLTFAVFLLALGFLV-CEA------------
TELEOST_MYOOC_A  ---------------------------MYRFTFAVFLLALGVLV-CEG------------
XENTR_NP_001025  ---------------------------MIVLPAAVFLSLLVFSQ----------------
XENLA_NP_001086  ---------------------------MIVLPAAVFLALLVFSQ----------------
PGH2_CHICK       ----------------------------MLLPCALLAALLAAGH----------------
CHICK_XP_422297  ----------------------------MLLPCALLAALLAAGH----------------
CHICK_XP_001231  ------------------------------------------------------------
PGH2_MUSVI_MAMM  ----------------------------MLARAGLLCASLSPPH----------------
PGH2_BOVIN       ----------------------------MLARALLLCAAVALSG----------------
PGH2_SHEEP       ----------------------------MLARALLLCAAV-VCG----------------
PGH2_HUMAN       ----------------------------MLARALLLCAVLALSH----------------
PGH2_CAVPO       ----------------------------MLARALLLCAALALGQ----------------
PGH2_MOUSE       ----------------------------MLFRAVLLCAALGLSQ----------------
PGH2_RAT         ----------------------------MLFRAVLLCAALALSH----------------
PGH2_RABIT       ----------------------------MLARALLLCAAVALSH----------------
PGH2_HORSE       ----------------------------MLARALLLCVALALGH----------------
                                                                             


                         70        80        90       100       110       120
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  --------------------------------VHYDPCCSFPCQHQSVCTSPDMISYQCD
XP_002123273_1_  --------------------------------ESYDPCCAFPCKHSAICTTLK-DDYECD
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  --------------------------------AAENPCCSMPCQNMGVCMREG-DSYSCD
BRAFL_AMPHIOXUS  ----------------------------------------MPCQNMGVCMTEG-DSYSCD
BRAFL_XP_002212  --------------------------------CSDNLCCSFPCQNMGVCMREG-DGYTCD
TELEOST_FUNHE_A  ------------------------------------------------------------
TETNI_CAF95578   --------------------------------SPVNPCCYLPCQHWGVCVRYGLDQYQCD
TELEOST_FUNHE_A  ---REPGCQGDE---VTT--------------STVNPCCYLPCKHWSVCVRYGEDKYECD
TELEOST_MYOOC_A  ---REPACRGDE---VTS--------------DTVNPCCYFPCQHWGVCVRYGEDKYECD
TELEOST_MICUN_B  ---REPACRGDE---VTS--------------STVNPCCYLPCQHWGVCVRYGEDKYECD
DANRE_AAI16576.  ---SVSFCAGEESPTSS---------------NTANPCCYYPCQNQGICVRYGLERYECD
DANRE_NP_705942  ---SVSFCAGEESPTSS---------------NTANPCCYYPCQNQGICVRYGLERYECD
SALFA_TELEOST_A  ---RLPTCRGEEVKDVST--------------NVVNPCCYYPCQNWALCVRFGIDRYECD
TELEOST_SALSA_N  ---RLPTCPGEEGKDAST--------------NVVNPCCYYPCQNWGVCVRFGIDRNECD
TELEOST_ONCMY_N  ---RLPTCRGEEVEDAST---------------VVNPCCYYPCQNWGVCVRFGIDRYECD
XENLA_AAI70301.  --------------------------------TKVNPCCYYPCQHKGVCVRFEMEEYQCD
XENLA_NP_001091  --------------------------------TKVNPCCYYPCQHKGVCVRFEMEEYQCD
CHICK_XP_425326  GRAALPHPTALLGSSKVPNAVAPRVDGDLSSLSAVNPCCYYPCQHQGVCVRVGLEGYECD
PGH1_MOUSE       ---LPPTPSVLLADPGVP--------------SPVNPCCYYPCQNQGVCVRFGLDNYQCD
PGH1_RAT         ---LLPPPPVLLTDAGVP--------------SPVNPCCYYPCQNQGVCVRFGLDHYQCD
PGH1_RABIT       LLLLPPPPPVLPADPGAP--------------APVNPCCYFPCQHQGVCVRVALDRYQCD
PGH1_HUMAN       -----PPLPVLLADPGAP--------------TPVNPCCYYPCQHQGICVRFGLDRYQCD
PGH1_SHEEP       -----SPSPVFSADPGAP--------------APVNPCCYYPCQHQGICVRFGLDRYQCD
PGH1_BOVIN       -----SPSPVLPADPGAP--------------APVNPCCYYPCQHQGICVRFGLDRYQCD
SHARK_SQUAC_AAL  --------------------------------TAINPCCYYPCQNKGICVNVGKEGYECD
HAGFISH_MYXGL_A  --------------------------------AADDPCCGSPCENKGVCVSVGFEDYECD
DANRE_NP_705943  ----------------------------------YDPCCAQPCQNQGVCLSKGADAYECD
DANRE_AAH63232.  ----------------------------------YDPCCAQPCQNQGVCLSKGADAYECD
DANRE_NP_001020  ----------------------------------ANPCCSHPCQNRGVCTEMGSDAYECD
TETNI_CAG11618.  ---------------------------------TGNPCCSEPCQNRGVCTPIGKDSYECD
TELEOST_DICLA_C  --------------------------------YLAQPCCSIPCQNRGACAGNGFDNYECD
TELEOST_ONCMY_N  --------------------------------EGVDPCCAQPCENRGLCNSKGFDNYECD
SALFO_TELEOST_A  --------------------------------EGVDPCCAQPCENRGLCNSKGFDNYECD
TELEOST_ONCMY_N  ----------------------------------GNPCCSQPCMNRGVCTAMGSEDYECD
TELEOST_FUNHE_A  --------------------------------VLGNACCSEPCQNRGVCTAMGSDSYECD
TELEOST_MICUN_B  ----------------------------------GNPCCAEPCQNKGVCTSLGAENYECD
TELEOST_MYOOC_A  ----------------------------------GNPCCSEPCQNRGVCTALGTDNYECD
XENTR_NP_001025  ---------------------------------AANPCCSNPCQNRGVCMTVGHDRYECD
XENLA_NP_001086  ---------------------------------AANPCCSNPCQNQGVCMTVGFDRYECD
PGH2_CHICK       ---------------------------------AANPCCSLPCQNRGVCMTTGFDRYECD
CHICK_XP_422297  ---------------------------------AANPCCSLPCQNRGVCMTTGFDRYECD
CHICK_XP_001231  -------------------------------------------------MTTGFDRYECD
PGH2_MUSVI_MAMM  ---------------------------------AANPCCSNPCQNQGVCMSIGFDQYMCD
PGH2_BOVIN       ---------------------------------AANPCCSHPCQNRGVCMSVGFDQYKCD
PGH2_SHEEP       ---------------------------------AANPCCSHPCQNRGVCMSVGFDQYKCD
PGH2_HUMAN       ---------------------------------TANPCCSHPCQNRGVCMSVGFDQYKCD
PGH2_CAVPO       ---------------------------------AANPCCSNPCQNRGECLSVGFDRYKCD
PGH2_MOUSE       ---------------------------------AANPCCSNPCQNRGECMSTGFDQYKCD
PGH2_RAT         ---------------------------------AANPCCSNPCQNRGECMSIGFDQYKCD
PGH2_RABIT       ---------------------------------AANPCCSNPCQNRGVCMTMGFDQYKCD
PGH2_HORSE       ---------------------------------AANPCCSNPCQNRGVCMSVGFDQYQCD
                                                                             


                        130       140       150       160       170       180
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  CTGTGYYGDECQHPYLSTRIKKWIKPSKSTTHYILTHFKWVWTIVNNVSWLRKTLMKAVL
XP_002123273_1_  CTGTGFYGRNCEYGYFSTYVTDLFRPSRSTLHHYMTNYSLLWKLVNNISWLQKKLMAVVL
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  CTRTGYYGQNCDIPEFWTSIKVALKPSKKTTHHLLTNYKWLWNIVNRIPFLSKFIMRAVY
BRAFL_AMPHIOXUS  CTRTGYYGQNCDIPEFWTSIKVALKPSKKTTHHLLTNYKWLWNIVNRIPFLSNFIMRAVY
BRAFL_XP_002212  CTGTGYYGQNCQTAEFWTMLKTALRPSDQTIDHLTKNYKWLWHIINNTQALRNFLMRLFS
TELEOST_FUNHE_A  ------------------------------------------------------------
TETNI_CAF95578   CTRTGYYGENCTVPEFWTRVRLLLRPSPDGAHYILTHFQWLWDIVNH-TFLRDFLMRLVI
TELEOST_FUNHE_A  CTHTGYYGENCSIPELWTRVRQFLKPSPDVVHYILTHFHWLWDIINN-TFLRNVLMRLVI
TELEOST_MYOOC_A  CTRTGYTGGNCTVPEFWSRVHQFLKPSPEVLHYILTHFNWLWDIINH-TFLRDVLMRMVL
TELEOST_MICUN_B  CTRTGYFGENCTVPEFWTRVRQFLKPSPDVVHYILTHFRWLWDIVNY-TYLRDVLMRLVL
DANRE_AAI16576.  CTRTGYYGENCTIPELWTRVYRLLKPSPNVVHYILTHFDWLWDLINR-SFLRDWLMRKVL
DANRE_NP_705942  CTRTGYYGENCTIPELWTRVYRLLKPSPNVVHYILTHFDWLWDLINR-SFLRDWLMRKVL
SALFA_TELEOST_A  CTRTGFYGQNCTIPEFWTRIHQQLKPSPDVVHYILTHFHWLWNLINR-TFMRDWLMRMVL
TELEOST_SALSA_N  CTRTGFYGQNCTIPEFWTRIHQQLKPSPDVVHYILTHFHWLWNLINR-TFMRDWLMRVVL
TELEOST_ONCMY_N  CTRTGFYGQNCTIPEFWTRVHQQLKPSPDVVHYILTHFHWLWNLINR-TFMRDWLMRVVL
XENLA_AAI70301.  CTRTGYYGTNCTIPEWWTKFRELIRPSPAFYHYILTRFKWFWDIINS-TFIRDFIVRLVL
XENLA_NP_001091  CTRTGYYGTNCTIPEWWTKFRELIRPSPAFYHYILTRFKWFWDIINS-TFIRDFIVRLVL
CHICK_XP_425326  CTRTGYFGANCTSPELWTRLRDLLKPSPTFYHFVLTHFRWFWDIINS-TFIRDTLMRLVL
PGH1_MOUSE       CTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYWLWEFVNA-TFIREVLMRLVL
PGH1_RAT         CTRTGYSGPNCTIPEIWTWLRSSLRPSPSFTHFLLTHGYWIWEFVNA-TFIREVLMRLVI
PGH1_RABIT       CTRTGYSGPNCTVPDLWTWLRSSLRPSPTFVHYLLTHVRWFWEFVNA-TFIRDTLMRLVL
PGH1_HUMAN       CTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNA-TFIREMLMRLVL
PGH1_SHEEP       CTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFMLTHGRWLWDFVNA-TFIRDTLMRLVL
PGH1_BOVIN       CTRTGYYGPNCTIPEIWTWLRTTLRPSPSFVHFLLTHGRWLWDFVNA-TFIRDKLMRLVL
SHARK_SQUAC_AAL  CTRTGYYGVNCTFPFSWSRVHKFLKPSPSSMHHVLTHYKWLWYIINNISFFSDTLMRLVL
HAGFISH_MYXGL_A  CTRTGYYGSNCTYPETWTWIVNMLKPLPDTVHYFLTHFAPFWSLVNRAAFLRDRVMRHVL
DANRE_NP_705943  CTRTGYYGENCTTPELLTRIKSALKPRPNVVHHILTHYKSIWDIINSISYLRDGIMRYIL
DANRE_AAH63232.  CTRTGYYGENCTTPELLTRIKSALKPRPNVVHHILTHYKSIWDIINSISYLRDGIMRYIL
DANRE_NP_001020  CTRTGYYGQNCTTPEFLTWVKVSLKPSPNTVHYILTHFKSLWNIINNVSFLRNGIMRYVL
TETNI_CAG11618.  CTLTGYAGPNCTTPEFLTWVKVSLKPSPNTVHYLLTHFKGFWNIVNNISFLRDAIMRYVL
TELEOST_DICLA_C  CTRTGYYGRNCTTPEFITQLKP-LKPAPNTAHYILTHSKGVWNVINLIPFVRQVIMVYVL
TELEOST_ONCMY_N  CTRTGYYGKNCTTPEFLTWIKISLKPAPNTIHYILTHYKGLWNVINKITFVRNAIMSYVL
SALFO_TELEOST_A  CTRTGYYGKNCTTPEFLTWIKISLKPAPNTVHYILTHYKGLWNVINKITFVRNAIMSYVL
TELEOST_ONCMY_N  CTRTGFYGHNCTQPEFFTWIKVSLKPTPNTVHYLLTNYKGVWNIINSISFLRDAIMRYVL
TELEOST_FUNHE_A  CTRTGYRGQNCTTPEFLTWIKISLKPTPNTVHYILTHFKGFWNIINNISFLRDAIMKYVL
TELEOST_MICUN_B  CTRTGYFGQNCTTPEFLTWLKITLKPSPNTVHYLLTHFKGFWNIVNNISFLRDGIMTYVL
TELEOST_MYOOC_A  CTRTGYHGHNCTTPEFLTWVKISLKPSPNTVHYILTHFKGFWNIINSISFFRDAIMRYVL
XENTR_NP_001025  CTRTGFYGENCTKPEFLSWLRLKLKPAPNTVHYILTHFKGLWNIVNNISFLRDAIMRYVL
XENLA_NP_001086  CTRTGFYGENCTKPEFLSWLRLKLKPTPNTVHYILSHFKGVWNIVNSMSFLRDAIMRYVL
PGH2_CHICK       CTRTGYYGENCTTPEFFTWLKLILKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVL
CHICK_XP_422297  CTRTGYYGENCTTPEFFTWLKLILKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVL
CHICK_XP_001231  CTRTGYYGENCTTPEFFTWLKLILKPTPNTVHYILTHFKGVWNIINNISFLRDTIMRYVL
PGH2_MUSVI_MAMM  CSRTGFYGENCSTPEFLTRVKLLLKPTPNTVHYILTHFKGVWNIVNKIPFLADVIMKYVR
PGH2_BOVIN       CTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNKISFLRNMIMRYVL
PGH2_SHEEP       CTRTGFYGENCTTPEFLTRIKLLLKPTPDTVHYILTHFKGVWNIVNKISFLRNMIMRYVL
PGH2_HUMAN       CTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVL
PGH2_CAVPO       CTRTGYYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMIYVL
PGH2_MOUSE       CTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVL
PGH2_RAT         CTRTGFYGENCTTPEFLTRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNSIMRYVL
PGH2_RABIT       CTRTGFYGENCSTPEFLTRIKLLLKPTPDTVHYILTHFKGVWNIVNSIPFLRNSIMKYVL
PGH2_HORSE       CTRTGFYGENCSTPEFLTRIKLFLKPTPNTVHYILTHFKGVWNIVNSFPFLRNAVMKYVL
                                                                             


                        190       200       210       220       230       240
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  AMRVSSVTEPSPYRGLSSYPSWSAYINDTMYVRTLPPVPTNCPTPMGVKGKPELPEISVL
XP_002123273_1_  KIRTNYVYEPSPYVGMDSYPTWDSYINKTVYARTLPPIPQDCPTPMGTKGPKTLPDIKVL
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  KIRSATVDSPPMYHTGHDYTSWDTYADRSYYTRALPPVPPGCPTPMGTAGRKELPSPQYI
BRAFL_AMPHIOXUS  KIRSATVDSPPMYHTGHDYTSWDTYADRSYYTRALPPVPPGCPTPMGTAGRKELPSPQYI
BRAFL_XP_002212  KLYVDKVDSPPLYHTGHDYTTWDTYSARSYYTRALPPVPKDCPTPMGTKGHKELPSPEYV
TELEOST_FUNHE_A  --------------------------NLSYYTRLLPPVPKDCPLPMGTKGKPVLPDIKEI
TETNI_CAF95578   TVRSNLVPYPPTYNSKYGYLNWESMSNLSYYTRILPPVPEDCPTPMGVKGKEELPDPELL
TELEOST_FUNHE_A  TARSNLIPSPPTFNSKYNYLSWESYYNLSYYTRILPPVPEDCPTPLGVKGRNGLPDPQVL
TELEOST_MYOOC_A  TVRSNLIPSPPTYNSKYDYLSWESYYNLSYYTRILPPVPKDCPTPLGVKGKAGLPDPELL
TELEOST_MICUN_B  TARSTLIPSPPTYNSKYSYLSWESYYNLSYYTRLLPPVPKDCPTPLGVKGKAGLPDPELL
DANRE_AAI16576.  TVRANLIPSPPTYNSRYDYLNWEAYSNITYYTRILPPVPNDCPTPMGTKGKIKLPDPKLL
DANRE_NP_705942  TVRANLIPSPPTYNSRYDYLNWEAYSNITYYTRILPPVPNDCPTPMGTKGKIKLPDPKLL
SALFA_TELEOST_A  TVRSNLIPSPPTFNSKYGYLSWESYSNVSYYTRILPPVPEDCPTPMGTKGKSVLPDPKLV
TELEOST_SALSA_N  TVRSNLIPSPPTFNSKYGYLSWESYSNVSYYTRILPPVPEDCPTPMGTKGKSVLPDPKLV
TELEOST_ONCMY_N  TVRSNLIPSPPTFNSKYGYLSWESYSNVSYYTRILPPVPEDCPTPMGTKGKSVLPDPKLV
XENLA_AAI70301.  TVRSNLIPSPPTYNSEYGYISWEAYSNVSYFTRVLPPVPHDCPTPMGTKGKKELPDATFL
XENLA_NP_001091  TVRSNLIPSPPTYNSEYGYISWEAYSNVSYFTRVLPPVPHDCPTPMGTKGKKELPDATFL
CHICK_XP_425326  TVRANLIPSPPTFNSQYGYISWEAYANVSYYTRILPPVPEECPTPMGTKGKQQLPDAQLL
PGH1_MOUSE       TVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDVQLL
PGH1_RAT         TVRSNLIPSPPTYNTAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDIHLL
PGH1_RABIT       TVRSNLIPSPPTYNLDYDYISWEAFSNVSYYTRVLPSVPKDCPTPMGTKGKKQLPDAQVL
PGH1_HUMAN       TVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLL
PGH1_SHEEP       TVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFL
PGH1_BOVIN       TVRSNLIPSPPTYNVAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAEFL
SHARK_SQUAC_AAL  TVRANIIPSPPTYNSDYTYVSWEGYSNISYLTRLLPPVPKDCPTPTGTQGYKKLPDSEQL
HAGFISH_MYXGL_A  MSRAHMVSSPPTYNADYGYKSWEAYSNLSYFTRLLPPVPQGCPTPMGRTGKKELPDAQKL
DANRE_NP_705943  LSRSHLVESPPTYNADYGYKSWEAYSNLSYYTRTLAPLPQNCPTP-------DLPNAKQV
DANRE_AAH63232.  LSRSHLVESPPTYNADYGYKSWEAYSNLSYYTRTLAPLPQNCPTP-------DLPNAKQV
DANRE_NP_001020  TSRAHLIDSPPTFNADYGYKSWEAYSNLSYYTRTLPPVPRDCPTPMGVAGKKELPDVKML
TETNI_CAG11618.  TSRSHLIESPPTFNADYDYKSWEAYSNLSYYTRTLPPVSKDCPTPMGVAGKKELPDSKVL
TELEOST_DICLA_C  TGRSPLIDSPPTYNVEYGYKSWEAYSNLSYYTRILPPVARDCPTPIGVVGKIALPDSKTA
TELEOST_ONCMY_N  TPRSHLVDSPPTYNADYGYKSWEAYSNLFYYTRTLPPLPKDCPTPMGTAGRAVLPDVKLV
SALFO_TELEOST_A  TSRSHLVDSPPTYNADYGYKSWEAYSNLSYYTRTLPPLPKDCPTPMGTAGRAVLPDVKLV
TELEOST_ONCMY_N  TSRSHLIDSPPTFNADYNYKSWEAYSNLSYYTRTLPPLPKDCPTPMGVVGKIELPDAKML
TELEOST_FUNHE_A  TSRSHMIDSPPTYNADYGYKSWEAYSNLSYYTRALPPVPEDCPTPMGVVGKKELPDVKVL
TELEOST_MICUN_B  TSRSHMIDSPPTFNADYSYKCWEAYSNLSYYTRTLPPVPKDCPTPMGVVGKKELPDAKVL
TELEOST_MYOOC_A  TSRSHLIDSPPTFNADYGYKSWEAYSNLSYYTRTLPPVPEDCPTPMGVVGKKELPDAKLL
XENTR_NP_001025  TSRSHLIDSPPTYNSHYGYKSWEAFSNLSYYTRTLPPVERDCPTPMGVKGMKELPSAKLV
XENLA_NP_001086  TSRSHLIDSPPTYNSHYTYKNWETYSNLSYYTRSLPPVERDCPTPMGVKGLKELPSSKLV
PGH2_CHICK       TSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVKGKKELPDSKLI
CHICK_XP_422297  TSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVKGKKELPDSKLI
CHICK_XP_001231  TSRSHLIDSPPTYNSDYSYKSWEAYSNLSYYTRSLPPVGHDCPTPMGVKGKKELPDSKLI
PGH2_MUSVI_MAMM  TSRSHCIEPPPTYNVHYAYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEI
PGH2_BOVIN       TSRSHLIESPPTYNVHYSYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEV
PGH2_SHEEP       TSRSHLIESPPTYNVHYSYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEV
PGH2_HUMAN       TSRSHLIDSPPTYNADYGYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEI
PGH2_CAVPO       TSRSHLIDSPPTYNAHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSNEV
PGH2_MOUSE       TSRSYLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEV
PGH2_RAT         TSRSHLIDSPPTYNVHYGYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEV
PGH2_RABIT       TSRSHMIDSPPTYNVHYNYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKDV
PGH2_HORSE       VSRSHLIESPPTYNAQYGYKSWESFSNLSYYTRALPPVADGCPTPMGVKGKKELPDSKEI
                                                                             


                        250       260       270       280       290       300
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  LEKFFKRRTFQPC-PQRTSVLFPFFAQHFTHMFFKTDPMKGMPYQW----GDQL-VDLSQ
XP_002123273_1_  RSLLFQRNKFEPC-PMRTNVFFAFFAQHFTHQFFKTNTIKGMPFQW----G-EHSVDLSH
LAMPREY_ACH7326  ------------------------------HQFFNTDPVRGPAFTR----ALGHGVDLNH
BRAFL_AMPHIOXUS  AETFLARRRFIPD-KRRTNVLFNFMAQHFTHQFFKTDFKKGAGRTW----G-DHGVDLSH
BRAFL_AMPHIOXUS  AETFLARRRFIPD-KRRTNVLFNFMAQHFTHQFFKTDFKKGAGRTW----G-DHGVDLSH
BRAFL_XP_002212  AETSLGAQNVPPGHETTHQHALRLHGAALHSSVLQNRLQEGTWSHLERPCGKFLFVDMSH
TELEOST_FUNHE_A  SERYFKRTEFRPD-PQGTNLMFAFMAQHFTHQFFKTSHKVDAGFTK----ALGHGVDASN
TETNI_CAF95578   VERLLRRRTFRPD-PQGTNLMFAFFAQHFTHQFFKTYNRMGLGFTK----ALDHGVGAGH
TELEOST_FUNHE_A  FERLLKRRTFRPD-PQGSNIMFAFFAQHFTHQFFKTYNRMGLGFTK----ALSHGVDAGH
TELEOST_MYOOC_A  VERLLKRRTFRPD-PQGSNLMFAFFAQHFTHQFFKTYNRMGVGFTK----ALAHGVDAGH
TELEOST_MICUN_B  VERLLKRRTFRLD-PQGSNLMFAFFAQHFTHQFFKTYNRMGLGYTK----ALAHGVDAGH
DANRE_AAI16576.  VEKFMLRRNFRLD-PQGTNLMFAFFAQHFTHQFFKTHNRVGLGFTK----GLGHGVDAGH
DANRE_NP_705942  VEKFMLRRNFRLD-PQGTNLMFAFFAQHFTHQFFKTHNRVGLGFTK----GLGHGVDAGH
SALFA_TELEOST_A  VEKFLLRRQFRPD-PKGTNLMFAFFAQHFTHQFFKTRNSMGLGFTS----ALGHGVDAGN
TELEOST_SALSA_N  VEKFLLRRQFRRD-PKGTNLMFAFFAQHFTHQFFKTRNSMGLGFTR----ALGHGVDAGN
TELEOST_ONCMY_N  VEKFLLRRQFRRD-PRGTNLMFAFFAQHFTHQFFKTRNSMGLGFTR----ALGHGVDAGN
XENLA_AAI70301.  VETFLKREKFIPD-PQGTNLLFAFFAQHFTHQFFKTYGRMGRGFIK----GFGHGVDLSH
XENLA_NP_001091  VETFLKREKFIPD-PQGTNLLFAFFAQHFTHQFFKTYGRMGRGFIK----GFGHGVDLSH
CHICK_XP_425326  AQRFLLRHKFEAD-PRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTK----ALGHGVDLGH
PGH1_MOUSE       AQQLLLRREFIPA-PQGTNILFAFFAQHFTHQFFKTSGKMGPGFTK----ALGHGVDLGH
PGH1_RAT         AQRLLLRREFIPG-PQGTNVLFAFFAQHFTHQFFKTSGKMGPGFTK----ALGHGVDLGH
PGH1_RABIT       AHRFLLRRTFIPD-PQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTK----ALGHGVDLGH
PGH1_HUMAN       ARRFLLRRKFIPD-PQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTK----ALGHGVDLGH
PGH1_SHEEP       SRRFLLRRKFIPD-PQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTK----ALGHGVDLGH
PGH1_BOVIN       SRRFLLRRKFIPD-PQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTK----ALGHGVDLGH
SHARK_SQUAC_AAL  AEEFLLRRKFIPD-PQGSNLMFAFFAQHFTHQFFRTDLDRGPGFTK----ALGHGVDLTH
HAGFISH_MYXGL_A  XERFLLRRTFIPD-PQGSNLLFAFFAQHFTHQFFKTDFKRGPGFTK----ALGHGVDLSH
DANRE_NP_705943  VEQVLLRKQFIPD-PQRSSLMFAFFAQHFSHQFFKSDFKKGPAFTK----ALGHGVDLGH
DANRE_AAH63232.  VEQVLLRKQFIPD-PQRSSLMFAFFAQHFSHQFFKSDFKKGPAFTK----ALGHGVDLGH
DANRE_NP_001020  AEKLLLRRKFIPD-PQRTNLMFAFFAQHFTHQFFKSDMKKGPAFTT----ALNHGVDLAH
TETNI_CAG11618.  AEKVLMRRQFIPD-PQRTSLMFAFFAQHFTHQFFKTDSKKGPAFTA----AQGHGVDLGH
TELEOST_DICLA_C  VEKLLRKR-FIPD-PQGTNIMFAFFAQHFTHQFFKSDMKKGPAFTV----AKGHGVDLSH
TELEOST_ONCMY_N  VEKVLLRKRFIPD-PQGSNLMFAFFAQHFTHQFFKSDFMKGPAFTK----ALGHGVDLNH
SALFO_TELEOST_A  VEKVLLRKRFIPD-PQGSNLMFAFFAQHFTHQFFKSDLKKGPAFTK----ALGHGVDLNH
TELEOST_ONCMY_N  AEKLLIRRKFIPD-PQGSSLMFAFFAQHFTHQFFKSDQKMGPAFTK----AKGHGVDLGH
TELEOST_FUNHE_A  AEKLLVRRRFIPD-PQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTV----AKGHGVDLGH
TELEOST_MICUN_B  AEKLLVRRQFIPD-PQGTSLMFAFFAQHFTHQFFKSDMKNGPAFTL----SKGHGVDLSH
TELEOST_MYOOC_A  AEKLFMRRQFIPD-PQGTSLMFAFFAQHFTHQFFKSDMKKGPAFTL----ATGHGVDLNH
XENTR_NP_001025  VEKFLMRRKFIPD-PQGSNVMFAFFAQHFTHQFFRTDMAKGAAFTK----ALGHGVDLNH
XENLA_NP_001086  VEKFLMRRKFIPD-PQGTNVMFAFFAQHFTHQFFKTDMAKGAAFTK----ALGHGVDLNH
PGH2_CHICK       VEKFLLRRKFIPD-PQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTK----AYGHGVDLNH
CHICK_XP_422297  VEKFLLRRKFIPD-PQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTK----AYGHGVDLNH
CHICK_XP_001231  VEKFLLRRKFIPD-PQGTNVMFTFFAQHFTHQFFKTDHKKGPGFTK----AYGHGVDLNH
PGH2_MUSVI_MAMM  VEKFLLRRKFIPD-PQGTNMMFAFFAQHFTHQFFKTDHKRGPGFTK----GLGHGVDLSH
PGH2_BOVIN       VKKVLLRRKFIPD-PQGTNLMFAFFAQHFTHQFFKTDFERGPAFTK----GKNHGVDLSH
PGH2_SHEEP       VKKVLLRRKFIPD-PQGTNLMFAFFAQHFTHQFFKTDIERGPAFTK----GKNHGVDLSH
PGH2_HUMAN       VEKLLLRRKFIPD-PQGSNMMFAFFAQHFTHQFFKTDHKRGPAFTN----GLGHGVDLNH
PGH2_CAVPO       LEKVLLRRKFIPD-PQGTNMMFAFFAQHFTHQFFKSDQKRGPAFTT----GLAHGVDLSH
PGH2_MOUSE       LEKVLLRREFIPD-PQGSNMMFAFFAQHFTHQFFKTDHKRGPGFTR----GLGHGVDLNH
PGH2_RAT         LEKVLLRREFIPD-PQGTNMMFAFFAQHFTHQFFKTDQKRGPGFTR----GLGHGVDLNH
PGH2_RABIT       VEKLLLRRKFIPD-PQGTNMMFAFFAQHFTHQFFKTDLKRGPAFTK----GLGHGVDLNH
PGH2_HORSE       VEKFLLRRKFIPD-PQGTNMMFAFFAQHFTHQFFKTDPKRGPAFTK----GLGHGVDLSH
                                               ################         #####


                        310       320       330       340       350       360
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  IYGHGEKRQHELRSHVNGKLKVSLVDGHEFPPLSNQTTANMSNINLLPQEYQFVFGHQGF
XP_002123273_1_  VYGHTIQRQHELRSHIDGKLKVFETNGEVFPPLTESANVTMS-GEKLMRGRKFAIGHPGF
LAMPREY_ACH7326  IYGGTLERQHQLRLFKDGKLKFQMIDGEAYPPVVRDAPVHMVYPEHVPASLRFAVGHEVY
BRAFL_AMPHIOXUS  IYGETVERQHQLRSFTDGKLKFQRVEGEVYPPSLADAPVHMIYPPYVPEGKRFAIGHEFF
BRAFL_AMPHIOXUS  IYGETVERQHQLRSFTDGKLKFQRVEGEVYPPSLADAPVHMIYPPYVPEGKRFAIGHEFF
BRAFL_XP_002212  VYGETVERQRQLRSFQDGKLKYQLVNGEAFPPSLQDASVHMIYPPDVPEEKRFALGHEFF
TELEOST_FUNHE_A  IYGEELERQHQLRLHKDGKLKYQLINGEMYPPTVSEVPVHMVYPEGFPAEQRLAIGQEVF
TETNI_CAF95578   IYGDTLDRQLQLRLHKDGKLKFQVLEGEVYPPSGMDVPIRMNYPSRIPPEKTFAIGQEMF
TELEOST_FUNHE_A  IYGDSLERQHLLRLFRDGKLKYQLIDGEVYPPSVTDAPVRMSYPPGIPVEKQMAIGQEVF
TELEOST_MYOOC_A  VYGDNLQRQLKLRLHKDGKLKYQLVDGQIYPPSVVDAPVKMSYPPGVPPEAQMAICQEVY
TELEOST_MICUN_B  IYGDSLKRQLQLRLHKDGKLKYQLIDGEIYPPSIADAPVRMNYPPGIPPEKQFAIGQEVF
DANRE_AAI16576.  IYGDSLDRQLELRLHKDGKLKYQVLNGDIYPPTVLHAQVKMSYPPSVPPEQQLAIGQEVF
DANRE_NP_705942  IYGDSLDRQLELRLHKDGKLKYQVLNGDIYPPTVLHAQVKMSYPPSVPPEQQLAIGQEVF
SALFA_TELEOST_A  VYGDNLVRQLNLRLLKDGKMKYQVVKGEVYPPTVAEAPVNMRYPQGTPVGQRMAIGQEVF
TELEOST_SALSA_N  VYGDNLERQLSLRLLKDGKMKYQVVKGEVYPPTVAEAPVNMRYPQGTPVGHRMAIGQEVF
TELEOST_ONCMY_N  VYGDNLVRQLNLRLLKDGKMKYQVVKGEVYPPTVAEAAVNMRYPQETPVGQRMAIGQEVF
XENLA_AAI70301.  IYGDSLERQHILRLFKDGKLKYQIINGETYPPTVVEAPVHMIYPENVPKEKQFAVGQEVF
XENLA_NP_001091  IYGDSLERQQILRLFKDGKLKYQIINGETYPPTVVEAPVHMIYPENVPKEKQFAVGQEVF
CHICK_XP_425326  LYGDNLQRQHQLRLFQDGKLKFQVVNGEVYPPSVTEVPVHMVYPPAIPKEKQLAMGQEVF
PGH1_MOUSE       IYGDNLERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPERQMAVGQEVF
PGH1_RAT         IYGDSLERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPEKQMAVGQEVF
PGH1_RABIT       IYGDSLERQYHLRLFKDGKLKYQVLDGEVYPPSVEEAPVLMHYPRGVPPRSQMAVGQEVF
PGH1_HUMAN       IYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVF
PGH1_SHEEP       IYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVF
PGH1_BOVIN       IYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVF
SHARK_SQUAC_AAL  IYGDSLERQHHLRLFKDGKLKYQVVNGEVFPPSVKEAPIQMKYPSTLPEEKRLAIGHDTF
HAGFISH_MYXGL_A  IYGDTLDKQHKLRLHNNGKLKFQMIDGEVFPPLVSEAPVDMIYPPHVPEAARFAVGHEAF
DANRE_NP_705943  IYGETLEVQHKLRLFKDGKLKYQVVDGEVYPPLVKDVQVEMHYPPHIPEEQKFAVGHEAF
DANRE_AAH63232.  IYGETLEVQHKLRLFKDGKLKYQVVDGEVYPPLVKDVQVEMHYPPHIPEEQKFAVGHEAF
DANRE_NP_001020  IYGQNLDRQHKLRLFKDGKLRYQILDGEVYPPTVSEVQVDMHYPPHVPESRRFAVGHEAF
TETNI_CAG11618.  IYGGDLERQHKLRLFKDGKLQHQVINGEVYPPTVKDVGVEMQYPPHIPESERFAVGHEAF
TELEOST_DICLA_C  IYGDKLERQHKLRLFKDGKLKYQMVNGEMYPPTVKEVGAEMHYPPHVPEAHRFAVGHEAF
TELEOST_ONCMY_N  VYGDTLERQHKLRLFKDGKLKYRVLNGEVYPPLVREVGAEMHYPPQVPEEHRFAVGHEHF
SALFO_TELEOST_A  VYGDSLERQHKLRLFKDGKLKYQVLNGEVYPPLVREVGAEMHYPPQVPEEHRFAVGHEHF
TELEOST_ONCMY_N  IYGENLERQHKLRLFKDGKLKFQVLDGEVYPPTVKEVGADMHYPPHVPESHRFAVGHEAF
TELEOST_FUNHE_A  IYGENLEKQHKLRLFKDGKLKYTMVNGEVYPPLVKDVGVEMHYPPHVPDSQRFAVGHEAF
TELEOST_MICUN_B  IYGDNLERQHKLRLFKDGKMKYQIVDGEVYPPTVQEVGVHMHYPPHVPDSHRFAVGHEAF
TELEOST_MYOOC_A  VYGGSMERQHKLRLRQDGKLKYQVLDGEVYPPTVKEVGADMHYPPHVPESHRFAVGHEAF
XENTR_NP_001025  IYGESLERQHKLRLMKGGKLKYQMISGEMYPPTVKTTGVDMVYPPHIPDHLQFAVGQEVF
XENLA_NP_001086  VYGESLERQHKLRLMKGGKLKYQMIDGDMYPPTVKSSGVDMAYPPHVPEHVQFAVGQEVF
PGH2_CHICK       IYGETLERQLKLRLRKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVF
CHICK_XP_422297  IYGETLERQLKLRLRKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVF
CHICK_XP_001231  IYGETLERQLKLRLRKDGKLKYQMIDGEMYPPTVKDTQAEMIYPPHVPEHLQFSVGQEVF
PGH2_MUSVI_MAMM  VYGETLDRQHKLRLFKDGKMKYQVIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVF
PGH2_BOVIN       IYGESLERQHKLRLFKDGKMKYQMINGEMYPPTVKDTQVEMIYPPHVPEHLKFAVGQEVF
PGH2_SHEEP       VYGESLERQHNRRLFKDGKMKYQMINGEMYPPTVKDTQVEMIYPPHIPEHLKFAVGQEVF
PGH2_HUMAN       IYGETLARQRKLRLFKDGKMKYQIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVF
PGH2_CAVPO       IYGETLDRQHKLRLFKDGKMKYQIIDGEMYPPTVKETQVEMMYPPYIPEHARFAVGQEVF
PGH2_MOUSE       IYGETLDRQHKLRLFKDGKLKYQVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVF
PGH2_RAT         VYGETLDRQHKLRLFQDGKLKYQVIGGEVYPPTVKDTQVDMIYPPHVPEHLRFAVGQEVF
PGH2_RABIT       IYGETLDRQHKLRLFKDGKMKYQVIDGEVYPPTVKDTQVEMIYPPHIPAHLQFAVGQEVF
PGH2_HORSE       IYGETLDRQHKLRLFKDGKMKYQIINGEVYPPTVKDTQVEMIYPPHIPEHLRFAVGQEVF
                 #########################################  #################


                        370       380       390       400       410       420
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  SLMPTFLIWSTIWLREHNRICDLIKEENPAWDDERIFQTARLVLT---------------
XP_002123273_1_  GAFPSFFVIATLWLREHNRVCDILKDLHPDWDDERLFQTARLILT---------------
LAMPREY_ACH7326  GLLPGLLVYATVWLREHNRVCDVLHARHPRWDDERLFQTARLILT---------------
BRAFL_AMPHIOXUS  GLLPGLFVYSTVWLREHNRVCDVMKELHPDWDDERLFQTARLILT---------------
BRAFL_AMPHIOXUS  GLLPGLFVYSTVWLREHNRVCDVMKELHPDWDDERLFQTARLILT---------------
BRAFL_XP_002212  GLLPGLFVWATVWLREHNRVCDVMKDLHPDWDDERLFQTARLILI---------------
TELEOST_FUNHE_A  GLVPGLTVYATIWLREHNRVCDILKGEHPTWDDEQLFQTARLIII---------------
TETNI_CAF95578   GIIPGLTMYATLWLREHNRVCDILKAEHPTWDDEQLFQTSRLIIIGEKGWTAVFLPYGTS
TELEOST_FUNHE_A  GLLPGLSLYATLWLREHNRVCDILKAEHPTWDDEQLFQTTRLIII---------------
TELEOST_MYOOC_A  GLLPGLGMFATLWLREHNRVCDILKAEHPTWDDEQLFQTARFVII---------------
TELEOST_MICUN_B  GLLPGLGMYATLWLREHNRVCDILKAAHPTWDDDQLFQTSRLIII---------------
DANRE_AAI16576.  GLLPGLGMYATLWLREHNRVCEILKQEHPTWGDEQLFQTARLIII---------------
DANRE_NP_705942  GLLPGLGMYATLWLREHNRVCEILKQEHPTWGDEQLFQTARLIII---------------
SALFA_TELEOST_A  GLLPGLTMYATLWLREHNRVCDILKAEHPTWGDEQLFQTARLIVI---------------
TELEOST_SALSA_N  GLLPGLTMYATLWLREHNRVCDILKAEHPTWGDEQLFQTARLIVI---------------
TELEOST_ONCMY_N  GLLPGLTMYATLWLREHNRVCDILKAEHPTWGDEQLFQTARLIVI---------------
XENLA_AAI70301.  GLLPGLMMYATLWLREHNRVCDVLKKEHPTWDDEQLFQTTRLILI---------------
XENLA_NP_001091  GLLPGLMMYATLWLREHNRVCDVLKKEHPTWDDEQLFQTTRLILI---------------
CHICK_XP_425326  GLLPGLCMYATLWLREHNRVCDILKQEHPTWGDEQLFQTARLILI---------------
PGH1_MOUSE       GLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILI---------------
PGH1_RAT         GLLPGLMLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILI---------------
PGH1_RABIT       GLLPGLMLYATLWLREHNRVCDLLKAEHPTWDDEQLFQTTRLILI---------------
PGH1_HUMAN       GLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILI---------------
PGH1_SHEEP       GLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILI---------------
PGH1_BOVIN       GLLPGLMVYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILI---------------
SHARK_SQUAC_AAL  GLIPGLMMYATIWLREHNRVCDILKEEHPVWSDEQLFQTTRLILI---------------
HAGFISH_MYXGL_A  GLVPGLMLYGTLWLREHNRVCDVLDVDHPEWDDERIFQTARLILI---------------
DANRE_NP_705943  GLVPGLMMYATIWLREHNRVCDIMKQEHPDWDDERIFQTTRLILI---------------
DANRE_AAH63232.  GLVPGLIMYATIWLREHNRVCDIMKQEHPDWDDERIFQTTRLILI---------------
DANRE_NP_001020  GLVPGLMMYATIWLREHNRVCDILKQEHPDWDDERLFQTSRLILI---------------
TETNI_CAG11618.  GLVPGLMMYATIWLREHNRVCDVLKEVHPDWDDERLFQTSRLILI---------------
TELEOST_DICLA_C  GLVPGLMMYATIWLREHNRVCDILQQEHPEWDDELSFQTSRLILI---------------
TELEOST_ONCMY_N  GLVPGLMMYATIWLREHNRVCDVLRQEHPEWDDERIFQTTRLILI---------------
SALFO_TELEOST_A  GLVPGLMMYATIWLREHNRVCDVLRQEHPEWDDERIFQTTRLILI---------------
TELEOST_ONCMY_N  GLVPGLMMYATIWLREHNRVCDVLKEVHPDWDDDRLFQTSRLILI---------------
TELEOST_FUNHE_A  GLVPGLLMYATIWLREHNRVCDVLKGVHPDWDDERLFQTTRLILI---------------
TELEOST_MICUN_B  GLVPGLMMYATIWLREHNRVCDVLKEVHPDWDDERLFQTTRLILI---------------
TELEOST_MYOOC_A  GLVPGLMMYATIWLREHNRVCDVLKEVHPDWDDERLFQTTRLILI---------------
XENTR_NP_001025  GLVPGLMMYSTIWLREHNRVCDILSNEHPEWDDERIFQTARLILI---------------
XENLA_NP_001086  GLVPGLMMYSTIWLREHNRVCDILAGEHPEWDDERIFQTARLILI---------------
PGH2_CHICK       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDEQLFQTTRLILI---------------
CHICK_XP_422297  GLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDEQLFQTTRLILI---------------
CHICK_XP_001231  GLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDEQLFQTTRLILI---------------
PGH2_MUSVI_MAMM  GLVPGLMMYATIWLREHNRVCDVLKQEQGEWDDERLFRRSRLILI---------------
PGH2_BOVIN       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILI---------------
PGH2_SHEEP       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILI---------------
PGH2_HUMAN       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWGDEQLFQTSRLILI---------------
PGH2_CAVPO       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDERLFQTSRLILI---------------
PGH2_MOUSE       GLVPGLMMYATIWLREHNRVCDILKQEHPEWGDEQLFQTSRLILI---------------
PGH2_RAT         GLVPGLMMYATIWLREHNRVCDILKQEHPEWDDERLFQTSRLILI---------------
PGH2_RABIT       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDEQLFQTSRLILI---------------
PGH2_HORSE       GLVPGLMMYATIWLREHNRVCDVLKQEHPEWDDERLFQTSRLILI---------------
                 #############################################               


                        430       440       450       460       470       480
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  ---------GETIKVVIEDYVQHLSGFHYKLLYDPELVQGGSHSFHNQIHVEFQLLYHWH
XP_002123273_1_  ---------GETLKIIVEDYVQHVSGFHFQLSYDPEILHKSTFSYNNQIHAEFHILYHWH
LAMPREY_ACH7326  ---------GETMKIVIEEYVQHLSGYNFHLKFDPTLLFGVNFQYSNRMSLEFNHLYHWH
BRAFL_AMPHIOXUS  ---------GETINIIINEYVQHLSGYNFDLFWDPELLFSDQFQYQNRIFVEFNHLYHWH
BRAFL_AMPHIOXUS  ---------GETINIIINEYVQHLSGYNFDLFWDPELLFSDQFQYQNRIFVEFNHLYHWH
BRAFL_XP_002212  ---------GETINIVIGEYVQHLAGKNFQLFWDPELLFEEQLQYQNSIFVEFNHLYHWH
TELEOST_FUNHE_A  ---------GEIINIIIEEYVQHLSGYYLKLKYDPSLLFGVRFQYTNRIALEFCYLYHWH
TETNI_CAF95578   CLTAALPLAGETIKIVIEEYVQQLSGYLLDLKFDPAMLFNTQFQYGNRIALEFTQLYHWH
TELEOST_FUNHE_A  ---------GETIRIVIEEYVQHLSGYLLQLKFDPTLLFNSNFQYGNRIALEFSQLYHWH
TELEOST_MYOOC_A  ---------GETIKIVIEEYVQQLSGYLLQLKFDPALLFNSNFQYGNRIALEFSQLYHWH
TELEOST_MICUN_B  ---------GETIKIVIEEYVQHLSGYLLQLKFDPTLLFNSNFQYGNRIALEFSQLYHWH
DANRE_AAI16576.  ---------GETIRIVIEEYVQHLSGYRLKLHFDPTLLFNSQFQYQNRISVEFNQLYHWH
DANRE_NP_705942  ---------GETIRIVIEEYVQHLSGYRLKLHFDPTLLFNSQFQYQNRISVEFNQLYHWH
SALFA_TELEOST_A  ---------GETIRIVIEEYVQHLSGYLLDLKFDPVLLFKSTFQYRNRIAVEFNQLYHWH
TELEOST_SALSA_N  ---------GETIRIVIEEYVQHLSGYLLDLKFDPVLLFKSTFQYRNRIAVEFKQLYHWH
TELEOST_ONCMY_N  ---------GETIRIVIEEYVQHLSGYLLDLKFDPVLLFKSTFQYRNRIAVEFKQLYHWH
XENLA_AAI70301.  ---------GETIKIVIEDYVQHLSGYYLKLKFDPELLFGVQFQYRNRIAVEFNQLYHWH
XENLA_NP_001091  ---------GETIKIVIEDYVQHLSGYYLKLKFDPELLFGVQFQYRNRIAVEFNQLYHWH
CHICK_XP_425326  ---------GETIKIVIEDYVQHLSGYFLNLKFDPELLFEQQFQYRNRIAVEFNQLYHWH
PGH1_MOUSE       ---------GETIKIVIEEYVQHLSGYFLQLKFDPELLFRAQFQYRNRIAMEFNHLYHWH
PGH1_RAT         ---------GETIKIIIEEYVQHLSGYFLQLKFDPELLFRAQFQYRNRIALEFNHLYHWH
PGH1_RABIT       ---------GETIKIVIEEYVQQLSGYFLQLKFDPEMLFSVQFQYRNRIAMEFNHLYHWH
PGH1_HUMAN       ---------GETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWH
PGH1_SHEEP       ---------GETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWH
PGH1_BOVIN       ---------GETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWH
SHARK_SQUAC_AAL  ---------GETIKIVIEDYVQHLSGYNFRMMFNPELLFTEHFQYSNRIAVEFDHLYHWH
HAGFISH_MYXGL_A  ---------GETIKIVIEDYVQHLSGYHFKLKFDPKLLFGQPFQYSNRISVEFNHLYHWH
DANRE_NP_705943  ---------GETIKIVIEDYVQHLSGYNFKLKFDPELIFSERFQYQNRIAAEFNTLYHWH
DANRE_AAH63232.  ---------GETIKIVIEDYVQHLSGYNFKLKFDPELIFSERFQYQNRIAAEFNTLYHWH
DANRE_NP_001020  ---------GETIKIVIEDYVQHLSGYYFKLKFDPELLFNERFQYQNRISSEFNTLYHWH
TETNI_CAG11618.  ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFKERFQYQNRIASEFNTLYHWH
TELEOST_DICLA_C  ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNSRFQYQNRI-VEFNTLYHWH
TELEOST_ONCMY_N  ---------GETIKIVIEDYVQHLSGYHFQLKFDPELLFNQRFQYQNRIAAEFNTLYHWH
SALFO_TELEOST_A  ---------GETIKIVIEDYVQHLSGYHFQLKFDPELLFNQRFQYQNRIAAEFNTLYHWH
TELEOST_ONCMY_N  ---------GETIKIVIEDYVQHLSGYNFKLKFDPELLFKERFQYQNRISSEFNTLYHWH
TELEOST_FUNHE_A  ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIASEFNTLYHWH
TELEOST_MICUN_B  ---------GETIKIVIEDYVQHLSGYNFKLKFDPQLLFNQRFQYQNRISSEFNTLYHWH
TELEOST_MYOOC_A  ---------GETIKIVIEDYVQHLSGYNFKLKFDPELLFNQRFQYQNRIASEFNTLYHWH
XENTR_NP_001025  ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQYQNRISAEFNTLYHWH
XENLA_NP_001086  ---------GETIKIVIEDYVQHLSGYHFKLKFDPQLLFNQRFQYQNRIAAEFNTLYHWH
PGH2_CHICK       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWH
CHICK_XP_422297  ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWH
CHICK_XP_001231  ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWH
PGH2_MUSVI_MAMM  ---------GETIKIVIEDYVRHLSGYHFSLKFDPELLFNQQFQYQNRIAAEFNTLYHWH
PGH2_BOVIN       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWH
PGH2_SHEEP       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWH
PGH2_HUMAN       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQNRIAAEFNTLYHWH
PGH2_CAVPO       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWH
PGH2_MOUSE       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWH
PGH2_RAT         ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIASEFNTLYHWH
PGH2_RABIT       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWH
PGH2_HORSE       ---------GETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWH
                          ########################################  #########


                        490       500       510       520       530       540
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  ALMPDQIEFNGKSYTMKRLLFNPEPVVKGGLKRTIEDLSNQWAGQVAGGKTQGAATLHVA
XP_002123273_1_  MLMPDFIELGEHVYPLKELLFNVDPVVEIGMETVLKQLSNQFAGKVVGGRNQGPELVAVV
LAMPREY_ACH7326  PLMPDSLLIDGRNYSYDEFLFNPGLLADKKLMPLVRSFMRQRAGTVSGGRNINKNLLHVA
BRAFL_AMPHIOXUS  PLMPDQFHINGSTYGMKDYLFNTDLVFKHGFGTTVDAMSRQIAGQI-GPKNIGPVNLKVA
BRAFL_AMPHIOXUS  PLMPDQFHINGSTYGMKEYLFNTDLVFKHGFGTTVDAMSRQIAGQI-GPKNIGPVNLKVA
BRAFL_XP_002212  VLMPDQFHINGTMYDMEEYLYNNDIVLKHGLNTTVDAMSRQIAGR-------------VA
TELEOST_FUNHE_A  PLMPDSFLIDGDELPYSQFLYNTSILMHYGVEKLVDAFSRQPAGQIGGGRNIHQAVLRVA
TETNI_CAF95578   PLMPDRFLIDGDEVLYEQFLYNTSVLIHYGVDKMVEAFSLQAAGQIGGGHNVPAMLTDVA
TELEOST_FUNHE_A  PLMPDSFHISGDELSYSQFLFNTSVLTHYGVEKLVDAFSRQAAGQIGGGHNINAVITKVI
TELEOST_MYOOC_A  PLMPESFLINGDELPYKRFLFNNTVLTHYGIENLVTAFSRQVAGQIGGGFNINAAVTKVS
TELEOST_MICUN_B  PLMPDYFIINGDEVSYTQFLFNTSVLTHYGIDKLVDAFSRQNAGQIGGGHNINPVVTKVA
DANRE_AAI16576.  PLMPDSFYIDGDLIQYSKFIFNTSILTHYGLEKLVEAFSIQPAGQIGGGHNIHPVVSGVA
DANRE_NP_705942  PLMPDSFYIDGDHIQYSKFIFNTSILTHYGLEKLVEAFSIQPAGQIGGGHNIHPVVSGVA
SALFA_TELEOST_A  PLMPDSFHIDGDVVSYSQFIFNTSIVTHYGVEKLVDAFSRQYAGQIGGGRNIHPVVTKVA
TELEOST_SALSA_N  PLMPDSFHIDGDVVPYSQFMFNTSIVTHYGVEKLVDAFSRQYAGQIGGGRNIHPVVTNVA
TELEOST_ONCMY_N  PLMPDSFHIDGDEVPYSQFIFNTSIVTHYGVEKLVDAFSRQCAGQIGGGRNIHPVVTNVA
XENLA_AAI70301.  PLMPEKFKIIEDEFGYSSFIYNTSIILDYGVEALVESFTKQIAGKIGGGKNHPPSLLKVA
XENLA_NP_001091  PLMPEKFKIIEDEFGYSSFIYNTSIILDYGVEALVESFTKQIAGKIGGGKNHPPSLLKVA
CHICK_XP_425326  ALMPDSFTIQGQEYSYEQFLYNTSMLMDYGVEALAESFSMQTAGRIGGGQNINANVLGVA
PGH1_MOUSE       PLMPNSFQVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQRAGRIGGGRNFDYHVLHVA
PGH1_RAT         PLMPDSFQVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQRAGRIGGGRNFDYHVLHVA
PGH1_RABIT       PLMPDSFQVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNIDHHVLHVA
PGH1_HUMAN       PLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVA
PGH1_SHEEP       PLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVA
PGH1_BOVIN       PLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVA
SHARK_SQUAC_AAL  PLMPDSFIVKGQDFSYKDFLFNTDILLNLGVDALVESFSKQIAGRIGGGRNIHQSLLHIA
HAGFISH_MYXGL_A  GLNPDAFRVGTQEYQYSQFLFNNTILLNHGVRGLLEAFNVQQAGRIGGGQNIHGALLHVA
DANRE_NP_705943  PLLPDNFQIQDQIYGYHQFVFNNSIVTTHGIRNMVDSFTKQTAGRVSGGRNLPPAVQGVA
DANRE_AAH63232.  PLLPDNFQIQDQIYGYHQFVFNNSIVTTHGIRNMVDSFTKQTAGRVSGGRNLPPAVQGVA
DANRE_NP_001020  PLMPDDFHIQDEVYNYQQFLFNTSILTDYGVNSLVESFNKQIAGRVAGGRNVAPAVLRVA
TETNI_CAG11618.  PLMPDSFHIEEKEYSYKEFVFNNSVVTRHGISHLVESFTKQLAGRVAGGRNVPKSLLYVS
TELEOST_DICLA_C  PLLPDTFLIGEEVYSYGQFVFNNSSAPEHGIKRLVSSFTNQIAGRVAGGRNIPLALGPVA
TELEOST_ONCMY_N  PLMPETFSIEDRAYTYPQFVFNNSLVTEHGINNLVESFTKQIAGRVAGGRNLPPALVGVA
SALFO_TELEOST_A  PLMPDTFSIEDRAYTYPQFVFNNSLVTEHGITNLVESFTKQIAGRVAGGRNLPPALVAVA
TELEOST_ONCMY_N  PLMPDAFHIQEQVYSYPQFVFNTSVVTTHGISNLVASFTKQIAGRVAGGRNVPPAVMMVA
TELEOST_FUNHE_A  PLMPDSFHIEEKDYSYKEFVFNTSVVTEHGINNLVDSFSKQIAGRVAGGRNVPGPIMYVA
TELEOST_MICUN_B  PLMPDSFQIEEKDYSYKQFVFNTSVVTEHGISNLVESFSKQVAGRVAGGRNVPGPILHVA
TELEOST_MYOOC_A  PLMPDSFHIEEKDYSYKEFVFNTSVVTEHGIGNLVESFTNQIAGRVAGGRNVPGPIMYVA
XENTR_NP_001025  PLLPDTFAISEKEYSYPQFLYNNSVMLNHGLTEMVESFSRQTAGRVAGGRNFPAAITRVA
XENLA_NP_001086  PLLPDTFAINEKEYSYPQFLYNNSVMIDHGLTQMVESFSRQSAGRVAGGRNFPAAITRVA
PGH2_CHICK       PLLPDTFQIHNQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVA
CHICK_XP_422297  PLLPDTFQIHNQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVA
CHICK_XP_001231  PLLPDTFQIHNQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVA
PGH2_MUSVI_MAMM  PLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFGESFSRQIAGRVAGGRNVPAAVQQEQ
PGH2_BOVIN       PLLPDVFQIDGQEYNYQQFIYNNSVLLEHGLTQFVESFTRQRAGRVAGGRNLPVAVEKVS
PGH2_SHEEP       PLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQFVESFTRQIAGRVAGRRNLPAAVEKVS
PGH2_HUMAN       PLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRVAGGRNVPPAVQKVS
PGH2_CAVPO       PLLPDTFQIDDQVYNFQQFLYNNSILVEHGLTQFVESFTKQIAGRVAGGRNVPLAVQRVA
PGH2_MOUSE       PLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPIAVQAVA
PGH2_RAT         PLLPDTFNIEDQEYTFKQFLYNNSILLEHGLAHFVESFTRQIAGRVAGGRNVPIAVQAVA
PGH2_RABIT       PLLPDTFQIDDQQYNYQQFLYNNSILLEHGLTQFVESFTRQIAGRVAGGRNVPPAVQKVA
PGH2_HORSE       PLLPDTFQIDDQEYNFQQFLYNNSILLEHGLTQFVESFSRQIAGRVAGGRNVPAAAQKIA
                 ############################################              ##


                        550       560       570       580       590       600
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  GLAIKNGRDLRMQSFNAYKEKFEMKKYTTFQELT--GEEEMAAELQKLYGDIDAVEYYIG
XP_002123273_1_  ELALKQTRQMRMCSFNKYRERFGMKPYTSFEELT--GETEVAALLRNLYYDIDALELFVG
LAMPREY_ACH7326  TSIIEHGRTLRLQSLNQYRHRFNMRPFTSFLELT--GDEAMAAEME--------------
BRAFL_AMPHIOXUS  VETIKHERNLRMQGLNQYRKRFGIPPYKTFLELTG-GDAEMADQLEEAYGDVDAVELYVG
BRAFL_AMPHIOXUS  VETIKHERNLRMQGLNQYRKRFGIPPYKTFLELT-GGDAEMADQLEEAYGDVDAVELYVG
BRAFL_XP_002212  VETIKHERELRMQPLNQYRKRFGMPPYRTFLELTA-GDTEMAAQLEEAYGDIDAVELYVG
TELEOST_FUNHE_A  EMVIRDSRAARLQPFNQYRKRFNLKPYSSFYELT--GDEEMARGLEELYGDIDALEFYPG
TETNI_CAF95578   VRTIKESRQLRLQPFNEYRKRFNLQPYTSFREFT--DNEEIARELEEFYGDIDALEYYPG
TELEOST_FUNHE_A  VGTIEESRQLRIQPFNEYRKRFNLEPYTSFRDFT--DSEEIASTLEELYGDIDTLEFYPG
TELEOST_MYOOC_A  VLTIKESRKLRMQPFNEYRKRFNLKPYTSFREFT--DNEEIARELEEFYGDVDALEFYPG
TELEOST_MICUN_B  VGAIKESRQLRMQPFNEYRKRFNLKPYTSFREFT--DNEEIARELEEFYGDIDSVEFYPG
DANRE_AAI16576.  ERVIVESRELRLQPFNEYRKRFNLKPYTSFAELT--GEQEMSNELEELYGHIDAMEFYPA
DANRE_NP_705942  ERVIVESRELRLQPFNEYRKRFNLKPYTSFAELT--GEQEMSKELEELYGHIDAMEFYPA
SALFA_TELEOST_A  EGVIEESRTLRLQPFNEYRKRFNLKPYTSFSDFT--GEEEMARELEELYGDIDALEFYPA
TELEOST_SALSA_N  EGVIEESRTLRLQPFNEYRKRFNLKPYTSFSDFT--GEEEIARELEELYGDIDALEFYPA
TELEOST_ONCMY_N  EGVIEESRTLRLQPFNEYRKRFNLKPYTSFSDFT--GEEEMARELEELYGDIDALEFYPA
XENLA_AAI70301.  AGVIEESRNLRLQPFNEYRKRFGLKAYKSFRDLT--GEEKMAAQLEEFYGDIDALEFYVG
XENLA_NP_001091  AGVIEESRNLRLQPFNEYRKRFGLKAYKSFRDLT--GEEKMAAQLEEFYGDIDALEFYVG
CHICK_XP_425326  VGVIEESRQLRLQPFNEYRKRFGLKPYTSFQELT--GEEDKAAELEELYGDIDALEFYPG
PGH1_MOUSE       VDVIKESREMRLQPFNEYRKRFGLKPYTSFQELT--GEKEMAAELEELYGDIDALEFYPG
PGH1_RAT         EDVIKESREMRLQSFNEYRKRFGLKPYTSFQEFT--GEKEMAAELEELYGDIDALEFYPG
PGH1_RABIT       VEVIKESREMRLQPFNEYRKRFGLKPYASFQELT--GETEMAAELEELYGDIDALEFYPG
PGH1_HUMAN       VDVIRESREMRLQPFNEYRKRFGMKPYTSFQELV--GEKEMAAELEELYGDIDALEFYPG
PGH1_SHEEP       VDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELT--GEKEMAAELEELYGDIDALEFYPG
PGH1_BOVIN       VDVIKESRELRLQPFNEYRKRFGMKPYTSFQELT--GEKEMAAELEELYGDIDALEFYPG
SHARK_SQUAC_AAL  IATIEHGRLLRFQPYNEYRKKLGLTPYKSFQELT--GEREVAARLEKLYGHIDAMEFYPA
HAGFISH_MYXGL_A  TASIKHGRKMRFQSLNQYRKQFGLQPYQSFEQLT--GETEMAADLAELYSDINAMEFYLG
DANRE_NP_705943  VKVLEQTRQMRYQSFNAYRRRFNMKPYSSFEEMT--GDKDLAAQLKELYGHVDKVELYPG
DANRE_AAH63232.  VKVLEQTRQMRYQSFNAYRRRFNMKPYSSFEEMT--GDKDLAAQLKELYGHVDKVELYPG
DANRE_NP_001020  IKSIENSRQMRYQSINAYRKRFNMKPYRSFEEMT--GEKEMAAELEEMYGDVDAVELYAG
TETNI_CAG11618.  IKSIENSRQMRYQSLNAYRKRFSMKPYSSFEEMT--GGTE--------------------
TELEOST_DICLA_C  TEVIDYSRDMRYQSLNVYRKRFELRPYSSFEDLT--GEPEIAAELEPLYADADIVELYPA
TELEOST_ONCMY_N  AKALEHSRDMRYQSLNAYRKRFNMRVYTSFEDLT--GETELAAELESLYGDVDAVELYPG
SALFO_TELEOST_A  AKALEHSRDMRYQSLNAYRKRFNMRAYTSFEDLT--GETELAAELESLYGDVDAVELYPG
TELEOST_ONCMY_N  LKSIENSRQMRYQSLNAYRKRFSMKPYASFEDLT--GEKEMAAELEEMYGHVDAVELYPG
TELEOST_FUNHE_A  IKSIENSRKMRYQSLNAYRKRFSMKPYTSFEDLT--GEKEMAAILEELYGDVDAVELYPG
TELEOST_MICUN_B  IKSIEDSRKMRYQSLNAYRKRFSMKPYTSFEDMT--GEKEMAAVLEEMYGHIDAVELYPG
TELEOST_MYOOC_A  IKSIENSRKMRYQSLNAYRKRFSMKPYSSFEDMT--GEKEMAAILEEFYGHVDAVELYPG
XENTR_NP_001025  VASIEHSREMRYQSLNEYRKRFMLKPFESFEELT--GEKEMSAELEKLYGDIDAMEFYPG
XENLA_NP_001086  VASIEHSREMRYQSLNEYRKRFMLKPFETFEELT--GEKEMSAELEKLYGDIDAMELYPG
PGH2_CHICK       KASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELT--GEKEMAAELEELYGDIDAMELYPG
CHICK_XP_422297  KASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELT--GEKEMAAELEELYGDIDAMELYPG
CHICK_XP_001231  KASIDQSRQMRYQSLNEYRKRFMLKPFKSFEELT--GEKEMAAELEELYGDIDAMELYPG
PGH2_MUSVI_MAMM  RASIDQSRQMKYQSLNEYRKRFSVKPYASFEELT--GEKEMAGELKALYQDIDAMELYPA
PGH2_BOVIN       KASIDQSREMKYQSFNEYRKRFLVKPYESFEELT--GEKEMAAELEALYGDIDAMEFYPA
PGH2_SHEEP       KASLDQSREMKYQSFNEYRKRFLLKPYESFEELT--GEKEMAAELEALYGDIDAMELYPA
PGH2_HUMAN       QASIDQSRQMKYQSFNEYRKRFMLKPYESFEELT--GEKEMSAELEALYGDIDAVELYPA
PGH2_CAVPO       KASIEHSRKMKYQSLNEYRKRFLMKPYTSFEELT--GEKEMAAGLEALYGDIDAMELYPA
PGH2_MOUSE       KASIDQSREMKYQSLNEYRKRFSLKPYTSFEELT--GEKEMAAELKALYSDIDVMELYPA
PGH2_RAT         KASIDQSREMKYQSLNEYRKRFSLKPYTSFEELT--GEKEMAAELKALYHDIDAMELYPA
PGH2_RABIT       KASIDQSRQMKYQSLNEYRKRFLLKPYESFEELT--GEKEMAAELEALYGDIDAVELYPA
PGH2_HORSE       KASIDQSREMKYQSLNEYRKRFRLTPYKSFEELT--GEKEMAAELEALYGDIDAMELYPA
                 ##################################                          


                        610       620       630       640       650       660
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  IMLEKRRSPQLFGETLTEMGSPYSLKGLYSNPINHKDWWKPSTFGGQKIMDVIKNTNLQS
XP_002123273_1_  YFVEHRRNRQVLGATMLEMGAPYSLKGVFGNPIGSPAWWKPSTFGGEVGFNIIKTTNLKN
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  LMVEQPAPGSVTSETIIEMGGPFSVKGLLSNPLCSPQWWKPSTFGGEAGFRMVKTATLKD
BRAFL_AMPHIOXUS  LMVEQPAPGSVTSETIIEMGGPFSVKGLLSNPLCSPQWWKPSTFGGEAGFRMVKTATLKD
BRAFL_XP_002212  WAIENPMPGSVHSETIVRMGSTFSFKGMLANPICSPGWWKPSTFGGEVGFNLLKTTTLKD
TELEOST_FUNHE_A  LLLEKTRPSSIFGESMVEMGAPFSLKGLLGNPINSPEYWKPSTFGGETGFNIIKTSTLKK
TETNI_CAF95578   LMLEKTRPGAIFGESMVEMGAPYSLKGLLGNPICSPEYWKPSTFGGKVGFDIVNSATLKD
TELEOST_FUNHE_A  LLLEKTRPGAIFGESMVEMGAPFSLKGLLGNPICSPQYWKPSTFGGKVGFDIVNSASLKK
TELEOST_MYOOC_A  LLLERTREGSIFGESMVEMGAPFSLKGLLGNPICSPVYWKPSTFGGKVGFDIVNSATLKK
TELEOST_MICUN_B  LMLEKTRSGAIFGESMVEMGAPFSLKGLLGNPICSPEYWKPSTFGGKVGFDIVNSATLKK
DANRE_AAI16576.  LLLEKTRPGAVFGESMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGKTGFDIVNSATLKK
DANRE_NP_705942  LLLEKTRPGAVFGESMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGKTGFDIVNSATLKK
SALFA_TELEOST_A  LMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPICSPEYWKPSTFGGQTGFDIVNSASLER
TELEOST_SALSA_N  IMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPICSPEYWKPSTFGGQTGFDIVNSASLER
TELEOST_ONCMY_N  IMLEKTRPNAIFGESMVEMGAPFSLKGLLGNPICSPEYWKPSTFGGQTGFDIVNSASLER
XENLA_AAI70301.  LLLEKPNPNSIFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGETGFNIVKTASIQK
XENLA_NP_001091  LLLEKPNPNSIFGESMVEIGAPFPLKGLLGNPICSPEYWKPSTFGGETGFNIVKTASIQK
CHICK_XP_425326  LLLEKPQPNGIFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGATGFEIVKTASLEK
PGH1_MOUSE       LLLEKCQPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKPSTFGGDVGFNLVNTASLKK
PGH1_RAT         LMLEKCQPNSLFGESMIEMGAPFSLKGLLGNPICSPEYWKPSTFGGDVGFNIVNTASLKK
PGH1_RABIT       LLLEKCQPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGSNLIKTATLKK
PGH1_HUMAN       LLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKK
PGH1_SHEEP       LLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKK
PGH1_BOVIN       LLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGDVGFNLVKTATLKK
SHARK_SQUAC_AAL  LLLEAPNKNSIFGESMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGKTGFDIVNTATFEK
HAGFISH_MYXGL_A  LMVEKPRQGALFGETMVEAGAPFSLKGLMGNAICSPEYWKPSTFGGNRGFEIVNSASLRR
DANRE_NP_705943  LLVEKSRPNSVFGETMVEMGAPYSLKGLMGNAICSPEYWKPSTFGGKVGFDIVNSASLKK
DANRE_AAH63232.  LLVEKSRPNSVFGETMVEMGAPYSLKGLMGNAICSPEYWKPSTFGGKVGFDIVNSASLKK
DANRE_NP_001020  LLVEKPRSNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGGKVGFEIVNSASLQN
TETNI_CAG11618.  ------------------------------------------------------------
TELEOST_DICLA_C  LLVEKPRPTAPFGETMVELGAPYSLKGLMGNLICSPLYWKPSTFGGVVGFSILNTASLES
TELEOST_ONCMY_N  LLVERPRPNAVFGETMVEMGAPYSLKGLLGNPICSPEYWMPSTFGGSVGFDILNTASLER
SALFO_TELEOST_A  LLVERPRPNAVFGETMVEMGAPYSLKGLLGNPICSPEYWMPSTFGGSVGFDIVNTASLER
TELEOST_ONCMY_N  LLVEKPRTNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTFGGSVGFDIINTASLQR
TELEOST_FUNHE_A  LLVEKPRTNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGTAGFDIVNTASLQR
TELEOST_MICUN_B  LLVEKPRSNAIFGETMVEMGAPYSFKGLMGNPICSPEYWKPSTFGGSVGFDIVNTASLQK
TELEOST_MYOOC_A  LLVEKPRSNAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGSEGFNIVNTASLQR
XENTR_NP_001025  LLVEQPRPGAIFGETMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGSVGFDIVNSASLQK
XENLA_NP_001086  LLVEQPRPGAIFGETMVEMGAPFSLKGLMGNPICSPEYWKPSTFGGSVGFDIVNSASFQK
PGH2_CHICK       LLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKVGFEIINTASLQK
CHICK_XP_422297  LLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKVGFEIINTASLQK
CHICK_XP_001231  LLVEKPRPGAIFGETMVEIGAPFSLKGLMGNTICSPEYWKPSTFGGKVGFEIINTASLQK
PGH2_MUSVI_MAMM  LLVEKPRPDAIFGETMVEIGAPFSLKGLMGNPICSPDYWKPSHFGGEVGFKIINTASIQS
PGH2_BOVIN       LLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEVGFKIINTASIQS
PGH2_SHEEP       LLVEKPAPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEVGFKIINTASIQS
PGH2_HUMAN       LLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEVGFQIINTASIQS
PGH2_CAVPO       LLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPHYWKPSTFGGEVGFQIVNTASIQS
PGH2_MOUSE       LLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFKIINTASIQS
PGH2_RAT         LLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEVGFRIINTASIQS
PGH2_RABIT       LLVERPRPDAIFGESMVEMGAPFSLKGLMGNPICSPNYWKPSTFGGEVGFKIVNTASIQS
PGH2_HORSE       LLVEKPRPDAIFGETMVELGAPFSLKGLLGNPICSPDYWKPSTFGGEVGFKIINTASIQS
                                                                             


                        670       680       690       700       710       720
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  LICRTVEG-CPHASFTVPDGATYRLPSDKQDVEND-R-TSAILIERARNADANKYMWTQD
XP_002123273_1_  FICRNVKG-CPDISFKVPQ--------------DV-P-YNSVEGKSSSPNTGIADVLISL
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  LFCRNTAGPCGLVSFAVPE--------------DVQPTGLPEEQDASSQGKGASQNDADL
BRAFL_AMPHIOXUS  LFCRNTAGPCGLVSFAVP------------------------------------------
BRAFL_XP_002212  LFCRNMNGPCGLVSFTVPE---------------------DVEPTGLTEDVESVGVPRKE
TELEOST_FUNHE_A  LVCLNTKW-CPYVDFHVPR--------------NE-E-----------------------
TETNI_CAF95578   LVCYNTKT-CPFVAFRVPK-----------------------------------------
TELEOST_FUNHE_A  LVCLNSRT-CPYVAFSVPA--------------EE-E---------------------PG
TELEOST_MYOOC_A  LVCLNTRT-CSYVAFRVPT--------------EE-Q---LK----------------TG
TELEOST_MICUN_B  LVCLNSKR-CPYVAFRVPT--------------EE-Q---LQ----------------RE
DANRE_AAI16576.  LVCLNTKW-CPYVSFHTPP---------------------------------------SD
DANRE_NP_705942  LVCLNTKW-CPYVSFHTPP---------------------------------------SD
SALFA_TELEOST_A  LVCLNTNW-CPYVAFNVPP--------------AG-Q-----------------------
TELEOST_SALSA_N  LVCLNTNW-CPYVAFNVPP--------------AG-Q-----------------------
TELEOST_ONCMY_N  LVCLNTNW-CPYVAFNVPP--------------AG-Q-----------------------
XENLA_AAI70301.  LVCLNVKT-CPFVAFHVPD-----------------------------------------
XENLA_NP_001091  LVCLNVKT-CPFVAFHVPD-----------------------------------------
CHICK_XP_425326  LVCLNVKK-CPYVAFHVPD--------------AA-A-AGET----------------DS
PGH1_MOUSE       LVCLNTKT-CPYVSFRVPD--------------YP-G---------------------DD
PGH1_RAT         LVCLNTKT-CPYVSFRVPD--------------YP-G---------------------DD
PGH1_RABIT       LVCLNTKT-CPYVSFRVPR--------------SS-G---------------------DD
PGH1_HUMAN       LVCLNTKT-CPYVSFRVPD--------------AS-Q---------------------DD
PGH1_SHEEP       LVCLNTKT-CPYVSFHVPD--------------PR-Q---------------------ED
PGH1_BOVIN       LVCLNTKT-CPYVSFHVPD--------------PH-R---------------------ED
SHARK_SQUAC_AAL  LICLNVKK-CPYVGFHVP-------------------------YNVDNDYEREKGK----
HAGFISH_MYXGL_A  LVCLNLQGPCPDVAFHVPR---------------D-N-QQDVVVNVTGSQGGSDGVTTTP
DANRE_NP_705943  LVCLNISGPCPMVSFQVPD--------------VK-F-QSSENVNSSSVHSTVNNI--NP
DANRE_AAH63232.  LVCLNVSGPCPMVSFQVPD--------------VK-F-QSSENVNSSSVHSTVNNI--NP
DANRE_NP_001020  LVCNNVNGPCPMASFYVPN--------------VK-D-SLPTTINASTSQS-DRNV--NP
TETNI_CAG11618.  ------------------------------------------------------------
TELEOST_DICLA_C  LICNNVKG-CPIASFEVPD------------------------FTSYPAINVSDIEDINP
TELEOST_ONCMY_N  LVCNNVKGSCPMVSFQVPD-------------------FLRAFESASVNTSEAHLSDMNP
SALFO_TELEOST_A  LVCSNVKGSCPMVSFQVPD-------------------FLRAFESASVNTSEAHLRGMNP
TELEOST_ONCMY_N  LVCSNVKGPCPVASFHVPD--------------VE-D-NRSNTINSSTAQSGSNDV--NP
TELEOST_FUNHE_A  LVCNNVRGPCPVASFYVPD--------------VK-E-TGSMTINSSTSHSRDSNI--NP
TELEOST_MICUN_B  LVCNNVQGPCPVASFHVPD--------------AP-M-TGSMIINSSTSHSRSSDI--NP
TELEOST_MYOOC_A  LVCNNVQGPCPVASFSGPD--------------VK-D-SGSMIINSSTS---NSDI--NP
XENTR_NP_001025  LICNNVRD-CPYTAFHVLK--------------SK-P-SEKDFINAS-SDSTLENV--KP
XENLA_NP_001086  LICNNVRD-CPYTAFHVLK--------------NK-P-SGKDFINAS-SDSTLENV--KP
PGH2_CHICK       LICNNVKG-CPFTAFHVLN--------------PE-P-TEA-TINVSTSNTAMEDI--NP
CHICK_XP_422297  LICNNVKG-CPFTAFHVLN--------------PE-P-TEA-TINVSTSNTAMEDI--NP
CHICK_XP_001231  LICNNVKG-CPFTAFHVLN--------------PE-P-TEA-TINVSTSNTAMEDI--NP
PGH2_MUSVI_MAMM  LICNNVKG-CPFTAFSVQD--------------PQ-L-TKTVTINGSSSHSGLDDI--NP
PGH2_BOVIN       LICSNVKG-CPFTSFSVQD--------------TH-L-TKTVTINASSSHSGLDDI--NP
PGH2_SHEEP       LICSNVKG-CPFTSFSVQD--------------AH-L-TKTVTINASSSHSGLDDI--NP
PGH2_HUMAN       LICNNVKG-CPFTSFSVPD--------------PE-L-IKTVTINASSSRSGLDDI--NP
PGH2_CAVPO       LICNNVKG-CPVTAFNLPD--------------PQ-L-AKTVTINASASHSRLEDL--SP
PGH2_MOUSE       LICNNVKG-CPFTSFNVQD--------------PQ-P-TKTATINASASHSRLDDI--NP
PGH2_RAT         LICNNVKG-CPFASFNVQD--------------PQ-P-TKTATINASASHSRLDDI--NP
PGH2_RABIT       LICNNVKG-CPFTSFNVPD--------------PQ-L-TKTVTINASASHSRLEDI--NP
PGH2_HORSE       LICNNVKG-CPFTAFSVQD--------------PQ-L-SKAVTINASASHSGLDDV--NP
                                                                             


                        730       740       750       760       770       780
                 =========+=========+=========+=========+=========+=========+
XP_002127674_1_  AKPNSIPDK-EL------------------------------------------------
XP_002123273_1_  TRPQVAQKS-QVKELKREEKTNEKSEL---------------------------------
LAMPREY_ACH7326  ------------------------------------------------------------
BRAFL_AMPHIOXUS  VPVNGVLSS-QDKHLHKEEKTSQDGSQDPETSSKVTANEKPVAKNEKLPKNGVAQKKEFQ
BRAFL_AMPHIOXUS  ------------------------------------------------------------
BRAFL_XP_002212  GISRDKQTSQNQEL----------------------------------------------
TELEOST_FUNHE_A  ---ERKPST-EL------------------------------------------------
TETNI_CAF95578   ----------EAQ-----------------------------------------------
TELEOST_FUNHE_A  RNDGKERSS-EL------------------------------------------------
TELEOST_MYOOC_A  NDDSKTRTD-EL------------------------------------------------
TELEOST_MICUN_B  SDDSKKRPD-EL------------------------------------------------
DANRE_AAI16576.  YKPQRTSHG-EL------------------------------------------------
DANRE_NP_705942  YKPQRTSHG-EL------------------------------------------------
SALFA_TELEOST_A  EPPPRKQST-EL------------------------------------------------
TELEOST_SALSA_N  EEPPRKQST-EL------------------------------------------------
TELEOST_ONCMY_N  EEPPRKQST-EL------------------------------------------------
XENLA_AAI70301.  VLPTLKKSD-EL------------------------------------------------
XENLA_NP_001091  VLPTLKKSD-EL------------------------------------------------
CHICK_XP_425326  GHAGGASST-EL------------------------------------------------
PGH1_MOUSE       GSVLVRRST-EL------------------------------------------------
PGH1_RAT         GSVFVRPST-EL------------------------------------------------
PGH1_RABIT       GPAAERRST-EL------------------------------------------------
PGH1_HUMAN       GPAVERPST-EL------------------------------------------------
PGH1_SHEEP       RPGVERPPT-EL------------------------------------------------
PGH1_BOVIN       RPGVERPPT-EL------------------------------------------------
SHARK_SQUAC_AAL  ------PST-EL------------------------------------------------
HAGFISH_MYXGL_A  HYVADQQSR-EL------------------------------------------------
DANRE_NP_705943  TVVLNERSS-EL------------------------------------------------
DANRE_AAH63232.  TVVLNERSS-EL------------------------------------------------
DANRE_NP_001020  TVLLKERTS-EL------------------------------------------------
TETNI_CAG11618.  ------------------------------------------------------------
TELEOST_DICLA_C  TVLLKEKTS-EL------------------------------------------------
TELEOST_ONCMY_N  GVLFKERTS-EL------------------------------------------------
SALFO_TELEOST_A  GVVFKERTL-EL------------------------------------------------
TELEOST_ONCMY_N  TVLLKEGTT-EL------------------------------------------------
TELEOST_FUNHE_A  TVILKERTS-EL------------------------------------------------
TELEOST_MICUN_B  TVILKERTT-EL------------------------------------------------
TELEOST_MYOOC_A  TVILKERTT-EL------------------------------------------------
XENTR_NP_001025  SLILKEHAS-EL------------------------------------------------
XENLA_NP_001086  SLILKEHTS-EL------------------------------------------------
PGH2_CHICK       TLLLKEQSA-EL------------------------------------------------
CHICK_XP_422297  TLLLKEQSA-EL------------------------------------------------
CHICK_XP_001231  TLLLKEQSA-EL------------------------------------------------
PGH2_MUSVI_MAMM  TVLLKERST-EL------------------------------------------------
PGH2_BOVIN       TVLLKERST-EL------------------------------------------------
PGH2_SHEEP       TVLLKERST-EL------------------------------------------------
PGH2_HUMAN       TVLLKERST-EL------------------------------------------------
PGH2_CAVPO       TVLLKGRST-EL------------------------------------------------
PGH2_MOUSE       TVLIKRRST-EL------------------------------------------------
PGH2_RAT         TVLIKRRST-EL------------------------------------------------
PGH2_RABIT       TVLLKGRST-EL------------------------------------------------
PGH2_HORSE       TVLLKERST-EL------------------------------------------------
                                                                             


                        790       800       810       820       830
                 =========+=========+=========+=========+=========+===
XP_002127674_1_  -----------------------------------------------------
XP_002123273_1_  -----------------------------------------------------
LAMPREY_ACH7326  -----------------------------------------------------
BRAFL_AMPHIOXUS  NGSPKNGRASKNDVPKNEPAPKNGLPTAFPKNGAAPRTYVNRTSCKQCDRIEL
BRAFL_AMPHIOXUS  -----------------------------------------------------
BRAFL_XP_002212  -----------------------------------------------------
TELEOST_FUNHE_A  -----------------------------------------------------
TETNI_CAF95578   -----------------------------------------------------
TELEOST_FUNHE_A  -----------------------------------------------------
TELEOST_MYOOC_A  -----------------------------------------------------
TELEOST_MICUN_B  -----------------------------------------------------
DANRE_AAI16576.  -----------------------------------------------------
DANRE_NP_705942  -----------------------------------------------------
SALFA_TELEOST_A  -----------------------------------------------------
TELEOST_SALSA_N  -----------------------------------------------------
TELEOST_ONCMY_N  -----------------------------------------------------
XENLA_AAI70301.  -----------------------------------------------------
XENLA_NP_001091  -----------------------------------------------------
CHICK_XP_425326  -----------------------------------------------------
PGH1_MOUSE       -----------------------------------------------------
PGH1_RAT         -----------------------------------------------------
PGH1_RABIT       -----------------------------------------------------
PGH1_HUMAN       -----------------------------------------------------
PGH1_SHEEP       -----------------------------------------------------
PGH1_BOVIN       -----------------------------------------------------
SHARK_SQUAC_AAL  -----------------------------------------------------
HAGFISH_MYXGL_A  -----------------------------------------------------
DANRE_NP_705943  -----------------------------------------------------
DANRE_AAH63232.  -----------------------------------------------------
DANRE_NP_001020  -----------------------------------------------------
TETNI_CAG11618.  -----------------------------------------------------
TELEOST_DICLA_C  -----------------------------------------------------
TELEOST_ONCMY_N  -----------------------------------------------------
SALFO_TELEOST_A  -----------------------------------------------------
TELEOST_ONCMY_N  -----------------------------------------------------
TELEOST_FUNHE_A  -----------------------------------------------------
TELEOST_MICUN_B  -----------------------------------------------------
TELEOST_MYOOC_A  -----------------------------------------------------
XENTR_NP_001025  -----------------------------------------------------
XENLA_NP_001086  -----------------------------------------------------
PGH2_CHICK       -----------------------------------------------------
CHICK_XP_422297  -----------------------------------------------------
CHICK_XP_001231  -----------------------------------------------------
PGH2_MUSVI_MAMM  -----------------------------------------------------
PGH2_BOVIN       -----------------------------------------------------
PGH2_SHEEP       -----------------------------------------------------
PGH2_HUMAN       -----------------------------------------------------
PGH2_CAVPO       -----------------------------------------------------
PGH2_MOUSE       -----------------------------------------------------
PGH2_RAT         -----------------------------------------------------
PGH2_RABIT       -----------------------------------------------------
PGH2_HORSE       -----------------------------------------------------
                                                                      





Parameters used Minimum Number Of Sequences For A Conserved Position: 27 Minimum Number Of Sequences For A Flanking Position: 44 Maximum Number Of Contiguous Nonconserved Positions: 8 Minimum Length Of A Block: 10 Allowed Gap Positions: None Use Similarity Matrices: Yes
Flank positions of the 6 selected block(s)
Flanks: [271  286]  [296  341]  [344  405]  [430  469]  [472  524]  [539  574]  

New number of positions in pasted_alignment-gb:  253  (30% of the original 833 positions)





Resulting alignment

Generated by Gblocks Server