1GZX:A(size=141) vs 1GZX:B(size=146)
Structure Alignment
Rmsd = 1.3 Z-Score = 6.5
Sequence identity = 43.2%
Aligned/gap positions = 139/8

Sequence alignment based on structure alignment.
Sequence alignment based on structure alignment. Position numbers according to sequence (starting from 1) and according to PDB are given as SSSS/PPPP, SSSS - sequence, PPPP - PDB.

1GZX:A - MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA CHAIN; CHAIN: A, C; OTHER_DETAILS: LIGANDED T STATE; MOL_ID: 2; CHAIN: B, D; MOLECULE: HEMOGLOBIN BETA CHAIN; OTHER_DETAILS: LIGANDED T STATE

1GZX:B - MOL_ID: 1; MOLECULE: HEMOGLOBIN ALPHA CHAIN; CHAIN: A, C; OTHER_DETAILS: LIGANDED T STATE; MOL_ID: 2; CHAIN: B, D; MOLECULE: HEMOGLOBIN BETA CHAIN; OTHER_DETAILS: LIGANDED T STATE




1GZX:A 1/2 VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDL------SHGSAQ 1GZX:B 2/146 HLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK

1GZX:A 55/56 VKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLP 1GZX:B 60/204 VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFG

1GZX:A 115/116 AEFTPAVHASLDKFLASVSTVLTSKYR 1GZX:B 120/264 KEFTPPVQAAYQKVVAGVANALAHKYH
View Results:
Download alignment as a PDB file

Quick view of structure alignment (using Rasmol)

Detailed analysis of alignment (using Compare3D Java applet)

Notes: (i) On some platforms (IntermnetExplorer7) Compare3D starts from the second click (ii) Compare3D may not work with some versions of InternetExplorer or across the firewall

View of structure alignment using Protein Explorer